close

SimulationCraft 406-19

for World of Warcraft 4.0.6 Live (build level 13623)

Table of Contents

Raid Summary

DPS Chart DPS Chart Gear Chart Gear Chart Timeline Distribution Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Death_Knight_Unholy_1h_T11_372 : 23449dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
23448.9 12.57 / 0.05% 3487.4 6.7 6.8 runic_power 19.46% 50.5
Origin http://chardev.org/?profile=34574
Talents http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
Glyphs
  • horn_of_winter
  • raise_dead
  • death_and_decay
  • death_coil

Charts

http://9.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:53629|14412|9978|9485|6400|6392|5994|5923|2361|2105|1312|831&chds=0,107258&chco=9482C9,9482C9,336600,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++53629++death_and_decay,9482C9,0,0,15|t++14412++death_coil,9482C9,1,0,15|t++9978++gargoyle_strike,336600,2,0,15|t++9485++festering_strike,C79C6E,3,0,15|t++6400++scourge_strike,C79C6E,4,0,15|t++6392++sweeping_claws,C79C6E,5,0,15|t++5994++plague_strike,C79C6E,6,0,15|t++5923++icy_touch,2459FF,7,0,15|t++2361++melee,C79C6E,8,0,15|t++2105++melee_main_hand,C79C6E,9,0,15|t++1312++melee_off_hand,C79C6E,10,0,15|t++831++melee,C79C6E,11,0,15&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:16,10,10,9,9,8,7,6,6,5,5,4,4,2,0,0,0,0&chds=0,100&chco=9482C9,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,9482C9,C79C6E,336600,C79C6E,2459FF,C79C6E,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|melee|sweeping_claws|scourge_strike|melee_main_hand|scourge_strike_shadow|death_and_decay|blood_plague|melee_off_hand|gargoyle_strike|claw|frost_fever|festering_strike|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:RdrMFQdnvxwz5743554443467876665320zxwwwwwvusqponmlkjihggfeddcccbaZZZZZYYYXXXXXWWWWWVVVVVVUUUVVVVVVUVUUUUVVVVUUUVVUUVVVVVVVWVVVVVVWVVVVVVVVVVVVVVVVVVUUUUUUUVVVUUUUVUVVVVVVVVVVVWWWVVWWXWVVVVVVVVVVVVVWWWWWWWWWWXWWXXWWVVVVUUUUUUUUUUUUVVVUVVVVVVVVWWWVVVVVVVVVVVVVVVVVVVVVVVUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVXZbcdddccccccbbbaaaZZZZYYYYYYYYZZZaaaabccdeffgggggffeedcbbbaaaaaZZZZYYYYYYYYXYYYYXXXXYYXXWWWVWVVVVVVVVVVVVVVVUUVVVVVVUUUUUVVUUVVVVVVVVVVUVVVVUVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=76&chtt=Death_Knight_Unholy_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uwyyz011222456777765320zxwvtsqppnmlkjihhgfgffeddccbbaaZZZYYYYYYYZZZZZZZaaaaaaaaZZZZYYYYXXXXXXXXXXXYYYYYYZZZZZZZaaaaaabaabbbbcccccccdcdcccccccbbaaaZZYYXXWWWWWWWWWWWWXXXXXYYYYZZZZZZaaaabbbcccdddeefffggghhhgggggfffffeeddddccccccccddddddcdcccccbbbbaaaaZZZZZZZYYYYYYYYYYYYYYYYYYYYXXXXXXXXXXXXYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZaaaabbbbcccccddddddddddddddcccccccccccccccccddddddeeeeefffffgggggggggggggggffffeedddccbbbaaaZZZZZZZZZZZZZaaaaaabbbbbbbbbbbbbbbbbbabbabb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=23449|max=48500&chxp=1,1,48,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,4,5,11,12,27,31,49,82,94,144,189,237,271,358,448,485,481,571,547,577,598,600,600,572,453,460,412,355,346,232,196,146,123,92,58,47,25,26,10,11,3,3,7,0,0,1&chds=0,600&chbh=5&chxt=x&chxl=0:|min=21079|avg=23449|max=25949&chxp=0,1,49,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_1h_T11_372 23449
blood_plague 1413 6.0% 7.2 67.55sec 89266 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3635 7600 15.6% 0.0% 99.6%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.16 7.16 150.23 150.23 0.0000 3.0000 639210
Direct Results Count Pct Average Min Max Total Damage
hit 7.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.37% 3635.27 2900 5300 460795
crit 23.5 15.63% 7599.55 6061 11077 178415

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 3.1 78.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.06 3.06 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.0 50.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.96 8.96 0.00 0.00 1.0162 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.0 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1750 7.5% 14.5 32.22sec 54545 53629 0 0 0 15.8% 0.0% 0.0% 0.0% 243 2788 5828 15.7% 0.0% 50.4%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.51 14.51 242.50 242.50 1.0171 0.9402 791472
Direct Results Count Pct Average Min Max Total Damage
hit 12.2 84.18% 0.00 0 0 0
crit 2.3 15.82% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 204.5 84.35% 2787.91 2272 4141 570262
crit 38.0 15.65% 5828.03 4749 8654 221210

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:16
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3654 15.6% 113.8 3.92sec 14519 14412 11854 24772 34578 20.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.83 113.83 0.00 0.00 1.0074 0.0000 1652668
Direct Results Count Pct Average Min Max Total Damage
hit 90.4 79.37% 11854.18 9830 16544 1071027
crit 23.5 20.63% 24771.99 20546 34578 581641

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 302.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 917 3.9% 43.1 10.52sec 9619 9485 8647 17822 23285 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.11 43.11 0.00 0.00 1.0141 0.0000 414644
Direct Results Count Pct Average Min Max Total Damage
hit 38.5 89.40% 8646.63 7462 11303 333215
crit 4.6 10.60% 17822.00 15372 23285 81429

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 1003 4.3% 8.7 54.27sec 52263 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5389 15.6% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.68 8.68 150.31 150.31 0.0000 3.0000 453747
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.38% 2579.87 2055 3767 327185
crit 23.5 15.62% 5389.32 4295 7874 126562

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 37 0.2% 2.7 109.15sec 6013 5923 5140 10752 15113 15.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0153 0.0000 16520
Direct Results Count Pct Average Min Max Total Damage
hit 2.3 84.45% 5140.03 4435 7526 11926
crit 0.4 15.55% 10752.42 9269 15113 4595

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2102 9.0% 263.2 1.72sec 3612 2105 4045 8334 11234 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
263.24 263.24 0.00 0.00 1.7157 0.0000 950894
Direct Results Count Pct Average Min Max Total Damage
hit 130.3 49.48% 4045.41 3414 5454 526956
crit 27.9 10.60% 8334.28 7033 11234 232463
glance 63.1 23.98% 3033.83 2560 4090 191475
miss 42.0 15.95% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1310 5.6% 262.4 1.72sec 2258 1312 2527 5204 7021 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.44 262.44 0.00 0.00 1.7209 0.0000 592521
Direct Results Count Pct Average Min Max Total Damage
hit 129.9 49.49% 2526.88 2134 3408 328222
crit 27.9 10.61% 5203.90 4395 7021 144970
glance 63.0 24.00% 1894.86 1600 2556 119328
miss 41.7 15.90% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.9 82.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.93 5.93 0.00 0.00 1.0164 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 17 0.1% 1.2 133.36sec 6112 5994 5490 11364 14741 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.23 1.23 0.00 0.00 1.0196 0.0000 7495
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 89.41% 5489.84 4831 7391 6019
crit 0.1 10.59% 11363.70 10136 14741 1476

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 2153 9.2% 150.1 2.99sec 6487 6400 5832 12010 15662 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.10 150.10 0.00 0.00 1.0136 0.0000 973778
Direct Results Count Pct Average Min Max Total Damage
hit 134.2 89.40% 5832.40 5042 7603 782643
crit 15.9 10.60% 12010.09 10387 15662 191135

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 1760 7.5% 150.1 2.99sec 5304 0 5304 0 12806 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.10 150.10 0.00 0.00 0.0000 0.0000 796184
Direct Results Count Pct Average Min Max Total Damage
hit 150.1 100.00% 5304.24 4122 12806 796184

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:5393.26
  • base_dd_max:5393.26
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.3 221.72sec 0 0 0 0 0 15.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.30 2.30 0.00 0.00 1.0053 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 1.9 84.29% 0.00 0 0 0
crit 0.4 15.71% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 359 1.5% 113.8 3.92sec 1426 0 0 0 0 0.0% 0.0% 0.0% 0.0% 407 398 0 0.0% 0.0% 90.0%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.83 113.83 407.22 407.22 0.0000 1.0000 162273
Direct Results Count Pct Average Min Max Total Damage
hit 113.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 407.2 100.00% 398.49 101 1344 162273

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:220.16
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1413
claw 605 42.9% 13.0 2.86sec 1630 0 1491 2983 2983 9.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21186
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.73% 1491.43 1491 1491 17591
crit 1.2 9.27% 2982.86 2983 2983 3596

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 807 57.1% 23.0 1.48sec 1228 831 1189 2379 2379 9.2% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 1.4776 0.0000 28252
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 66.90% 1189.27 1189 1189 18300
crit 2.1 9.25% 2378.55 2379 2379 5059
glance 5.5 23.85% 891.95 892 892 4893

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1744
gargoyle_strike 1744 100.0% 48.4 6.52sec 11255 9978 11255 0 16064 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.44 48.44 0.00 0.00 1.1280 0.0000 545265
Direct Results Count Pct Average Min Max Total Damage
hit 48.4 100.00% 11255.47 8668 16064 545265

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 5660
claw 1061 18.7% 117.4 3.80sec 4087 0 3742 7484 11262 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.44 117.44 0.00 0.00 0.0000 0.0000 479950
Direct Results Count Pct Average Min Max Total Damage
hit 106.6 90.79% 3741.90 2746 5631 398972
crit 10.8 9.21% 7483.93 5492 11262 80978

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2358 41.7% 341.1 1.33sec 3127 2361 3030 6058 9221 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
341.07 341.07 0.00 0.00 1.3248 0.0000 1066596
Direct Results Count Pct Average Min Max Total Damage
hit 227.9 66.81% 3030.04 1861 4611 690486
crit 31.4 9.22% 6057.75 3722 9221 190409
glance 81.8 23.97% 2271.46 1396 3458 185702

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2241 39.6% 153.0 2.79sec 6628 6392 6071 12144 16633 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
152.95 152.95 0.00 0.00 1.0370 0.0000 1013837
Direct Results Count Pct Average Min Max Total Damage
hit 138.9 90.82% 6071.07 5273 8316 843342
crit 14.0 9.18% 12143.56 10545 16633 170496

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_1h_T11_372
death_coil runic_power 95.5% 569.2 26
summon_gargoyle runic_power 4.5% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 43.4% 102.2 40
sweeping_claws energy 56.6% 165.7 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 180.3 0.1 0.3%
horn_of_winter runic_power 17.9 179.0 10.0 0.0%
rune_abilities runic_power 223.6 2710.4 12.1 0.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 430.7 3.1 0.0%
pet - ghoul energy
energy_regen energy 1809.6 10736.9 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.3 0.0 57.5sec 57.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.0 0.0 50.8sec 50.8sec 57% 57%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.4 45.8 49.2sec 8.1sec 84% 83%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 43.8 0.0 10.1sec 10.1sec 34% 34%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.3 38.4 50.4sec 9.3sec 36% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 28.5 0.2 15.6sec 15.4sec 4% 4%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 79.5 287.5sec 5.5sec 98% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.1 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.3 48.4 220.8sec 6.2sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.87%
σ of the average dps 6.2862
2 * σ / μ 0.0536%
95% Confidence Intervall ( μ ± 2σ ) ( 23436.30 - 23461.44 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 23430.01 - 23467.73 )
Sample Data
σ 628.6237
Minimum 21079.33
Maximum 25948.67
Spread ( max - min ) 4869.34
Range ( max - min ) / 2 2434.67
Range% 10.38
10th Percentile 22678.43
90th Percentile 24287.34
( 90th Percentile - 10th Percentile ) 1608.90
Approx. Iterations needed for
1% dps error 28
0.1% dps error 2874
0.1 scale factor error with delta=300 3512
0.05 scale factor error with delta=300 14050
0.01 scale factor error with delta=300 351260
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQPPPN5PPNPMPPLMQRDPPPMPPPMROQRPQPRPPPMPPRRPQRTKLPPPMRUPRPPROQRDQRPPPRNPPPPRQURPQRPNPPRROPPPRBAUPRQPRQPRUOPPRSD5PRNPPQRRPQRPPPRPNPPRUROQRPBARPSPPPRUPQR9RPPQGOPRDRPPPQRUPQRPPPRPPPRORBUAPNQNRPQPRPPPNRDNPRUPRQ5ORQPPPRPSPRRNPPPQRUPQRPRPPPRPPORQURPQRDPPRRPCPAURPQROQRPPPRPSPNPPRUPQNRPQNRTDHJPPMPRPRU9QNPRQPPGPP5PRPCBRRPUQROQRPPPRPSPPRPUPRQDRQPORRPPPRUPNRPRAQPRQPRUPORPSPPRPPQRURPRQDPRPPORSPP7URPB5APRQPRQPRPUPPROSPPRNPQRDQRUPPRPPPRP9OR

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7000 5632 4914
Agility 721 138 20
Stamina 7621 6000 5825
Intellect 55 53 20
Spirit 85 85 20
Health 149663 127025 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.48% 18.48% 971
Spell Crit 12.45% 7.45% 1336
Spell Haste 12.35% 7.00% 896
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16794 12394 190
Melee Hit 11.08% 11.08% 971
Melee Crit 15.41% 8.02% 1336
Melee Haste 23.05% 7.00% 896
Expertise 27.04 27.04 812
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.08% 16.08% 1448

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 2
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 1
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 0
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_1h_T11_372
origin="http://chardev.org/?profile=34574"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
glyphs=horn_of_winter/raise_dead/death_and_decay/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
# Gear Summary # gear_strength=4914
# gear_agility=20
# gear_stamina=5825
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=812
# gear_hit_rating=971
# gear_crit_rating=1336
# gear_haste_rating=896
# gear_mastery_rating=1448
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_2h_T11_372 : 26813dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26812.7 13.45 / 0.05% 3717.3 7.2 7.3 runic_power 11.09% 55.5
Origin http://chardev.org/?profile=87453
Talents http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
Glyphs
  • blood_boil
  • pestilence
  • antimagic_shell
  • horn_of_winter
  • blood_tap
  • raise_ally
  • scourge_strike
  • raise_dead
  • death_coil

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:36067|13589|13342|10402|8979|8528|6435|5829|2798|2610|915&chds=0,72135&chco=9482C9,9482C9,C79C6E,336600,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E&chm=t++36067++death_and_decay,9482C9,0,0,15|t++13589++death_coil,9482C9,1,0,15|t++13342++festering_strike,C79C6E,2,0,15|t++10402++gargoyle_strike,336600,3,0,15|t++8979++scourge_strike,C79C6E,4,0,15|t++8528++plague_strike,C79C6E,5,0,15|t++6435++sweeping_claws,C79C6E,6,0,15|t++5829++icy_touch,2459FF,7,0,15|t++2798++melee_main_hand,C79C6E,8,0,15|t++2610++melee,C79C6E,9,0,15|t++915++melee,C79C6E,10,0,15&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:14,13,13,10,10,9,6,5,5,4,4,4,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,9482C9,9482C9,C79C6E,2459FF,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|scourge_strike_shadow|scourge_strike|melee_main_hand|melee|sweeping_claws|gargoyle_strike|festering_strike|blood_plague|death_and_decay|claw|frost_fever|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:QcpMENWemnqv23224324554578776765332110000zyxwutttsrrrrrqqppponnmmlkkjjiiihhggffeeddccccbbaaaaaZZZZZZZYYYYYYYYYYYYYXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXXYYXXXXXXXXXXXWXWXXXXXXXXXXXXXYYZYWWWWWWXXXYYZZaabbcccddeefffffeddcbbaaaZZZZYYYYYYYYYYXYYXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXYYYYYYXXYXXXXXXXXXYYYXXXXXXXXYXXXXYXXXYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaabbcdeffhhijkkllllllllkjiihhhhggggggghhhhhhhhiiiiihhgfeedddcccbbaaaaaZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=80&chtt=Death_Knight_Unholy_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:vwyzz0011113567778755310zyxwvttsqponlkjiihhhhggffeeddcccbccbcbccccccccccddddddddddccbbbbbbaaaaaaaaaaZZZZaaaaaaaabbbbbcccdddeeeffffffgfffffffeedddccbbaaaZaZZZZZZZZZaZaaaaaaaabbbbbccccdddeeffghhhiijjjkkkkkkkkkjjjiihhhhggggfgfffffffffffffeeeeddddcccccbbbbbbbbbbbbbbbbccbbbbbbbbbbbaaaaaabaaaabaaaaaaaaaaaaaaaaaZZZZaaaaaabbbbbcccccdddddddddddddddddddddddddeeeefffgggghhiiijjkkkllmmnnnooooooonnnmmmllkjjihhgffeedddccccccccccccccccccccccccccccbccccbcbccbccbcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26813|max=50965&chxp=1,1,53,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,7,4,5,11,16,29,28,56,70,92,141,175,201,256,299,433,481,544,556,536,548,617,593,559,537,501,462,429,387,346,222,228,176,126,98,67,62,35,25,10,11,7,7,1,0,0,1,2&chds=0,617&chbh=5&chxt=x&chxl=0:|min=24396|avg=26813|max=29517&chxp=0,1,47,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_2h_T11_372 26813
blood_plague 1332 5.0% 6.3 77.67sec 95885 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3518 7351 12.8% 0.0% 99.7%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.28 6.28 150.33 150.33 0.0000 3.0000 602568
Direct Results Count Pct Average Min Max Total Damage
hit 6.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.22% 3518.40 2817 5142 461336
crit 19.2 12.78% 7350.61 5888 10746 141232

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 2.1 109.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.10 2.10 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.4 48.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.43 9.43 0.00 0.00 1.0120 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.4 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1184 4.4% 14.7 31.85sec 36529 36067 0 0 0 12.8% 0.0% 0.0% 0.0% 174 2702 5647 12.7% 0.0% 35.2%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.66 14.66 174.01 174.01 1.0128 0.9158 535483
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 87.23% 0.00 0 0 0
crit 1.9 12.77% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.9 87.27% 2702.41 2208 4017 410365
crit 22.2 12.73% 5647.18 4614 8395 125118

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:11
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3849 14.4% 127.2 3.52sec 13680 13589 11459 23948 33535 17.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.25 127.25 0.00 0.00 1.0067 0.0000 1740732
Direct Results Count Pct Average Min Max Total Damage
hit 104.6 82.22% 11459.17 9543 16045 1198827
crit 22.6 17.78% 23947.89 19946 33535 541905

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.97 1.97 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 1451 5.4% 48.6 9.33sec 13496 13342 12789 26373 33998 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.63 48.63 0.00 0.00 1.0115 0.0000 656284
Direct Results Count Pct Average Min Max Total Damage
hit 43.8 90.01% 12789.03 11218 16504 559790
crit 3.7 7.52% 26373.16 23109 33998 96494
dodge 1.2 2.47% 0.00 0 0 0

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 977 3.6% 8.4 55.68sec 52781 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5393 12.8% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.37 8.37 150.34 150.34 0.0000 3.0000 441875
Direct Results Count Pct Average Min Max Total Damage
hit 8.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.2 87.25% 2580.47 2064 3777 338484
crit 19.2 12.75% 5392.87 4313 7894 103390

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 35 0.1% 2.7 116.01sec 5895 5829 5183 10825 15768 12.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.71 2.71 0.00 0.00 1.0114 0.0000 15954
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.39% 5183.46 4338 7545 12259
crit 0.3 12.61% 10825.26 9302 15768 3695

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2792 10.4% 197.0 2.30sec 6411 2798 6430 13247 17541 7.7% 2.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
196.97 196.97 0.00 0.00 2.2914 0.0000 1262770
Direct Results Count Pct Average Min Max Total Damage
hit 129.7 65.87% 6430.14 5531 8515 834285
crit 15.2 7.69% 13246.65 11394 17541 200691
glance 47.2 23.98% 4823.78 4148 6386 227794
dodge 4.8 2.46% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.7 87.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.67 5.67 0.00 0.00 1.0137 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 12 0.0% 0.6 141.95sec 8668 8528 8227 16981 21701 7.2% 2.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.63 0.63 0.00 0.00 1.0164 0.0000 5493
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 90.44% 8227.24 7458 10858 4715
crit 0.0 7.23% 16980.51 15364 21701 778
dodge 0.0 2.34% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 3457 12.9% 172.3 2.60sec 9073 8979 8598 17708 22804 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
172.29 172.29 0.00 0.00 1.0104 0.0000 1563192
Direct Results Count Pct Average Min Max Total Damage
hit 155.1 90.00% 8598.08 7546 11070 1333223
crit 13.0 7.54% 17708.34 15545 22804 229969
dodge 4.2 2.46% 0.00 0 0 0

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 3555 13.3% 168.0 2.67sec 9567 0 9567 0 23453 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
168.05 168.05 0.00 0.00 0.0000 0.0000 1607653
Direct Results Count Pct Average Min Max Total Damage
hit 168.0 100.00% 9566.68 7760 23453 1607653

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:8013.99
  • base_dd_max:8013.99
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.8 195.56sec 0 0 0 0 0 13.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0056 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 86.99% 0.00 0 0 0
crit 0.4 13.01% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 378 1.4% 127.2 3.52sec 1342 0 0 0 0 0.0% 0.0% 0.0% 0.0% 411 416 0 0.0% 0.0% 90.8%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.25 127.25 410.70 410.70 0.0000 1.0000 170728
Direct Results Count Pct Average Min Max Total Damage
hit 127.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 410.7 100.00% 415.70 98 1362 170728

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:481.35
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1564
claw 651 41.7% 14.0 2.62sec 1629 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 0.0000 0.0000 22802
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 90.80% 1491.43 1491 1491 18958
crit 1.3 9.20% 2982.86 2983 2983 3843

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 912 58.3% 26.0 1.34sec 1228 915 1189 2379 2379 9.3% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.00 26.00 0.00 0.00 1.3426 0.0000 31934
Direct Results Count Pct Average Min Max Total Damage
hit 17.3 66.68% 1189.27 1189 1189 20619
crit 2.4 9.28% 2378.55 2379 2379 5741
glance 6.2 24.03% 891.95 892 892 5574

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1867
gargoyle_strike 1867 100.0% 62.6 5.91sec 11009 10402 11009 0 16107 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.58 62.58 0.00 0.00 1.0584 0.0000 688990
Direct Results Count Pct Average Min Max Total Damage
hit 62.6 100.00% 11009.36 8704 16107 688990

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 6144
claw 1036 16.9% 115.4 3.86sec 4060 0 3719 7435 11289 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.42 115.42 0.00 0.00 0.0000 0.0000 468640
Direct Results Count Pct Average Min Max Total Damage
hit 104.8 90.81% 3719.02 2755 5645 389804
crit 10.6 9.19% 7434.55 5511 11289 78836

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2607 42.4% 373.3 1.21sec 3159 2610 3061 6119 9243 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
373.32 373.32 0.00 0.00 1.2105 0.0000 1179320
Direct Results Count Pct Average Min Max Total Damage
hit 249.4 66.81% 3060.94 1867 4622 763472
crit 34.4 9.20% 6119.00 3734 9243 210258
glance 89.5 23.98% 2296.15 1400 3466 205590

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2501 40.7% 169.6 2.52sec 6673 6435 6109 12212 16673 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
169.56 169.56 0.00 0.00 1.0369 0.0000 1131367
Direct Results Count Pct Average Min Max Total Damage
hit 153.9 90.77% 6109.40 5291 8337 940282
crit 15.6 9.23% 12211.78 10581 16673 191085

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_2h_T11_372
death_coil runic_power 94.9% 562.1 24
summon_gargoyle runic_power 5.1% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 40.5% 101.5 40
sweeping_claws energy 59.5% 166.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 179.7 0.1 0.7%
horn_of_winter runic_power 15.0 150.1 10.0 0.0%
rune_abilities runic_power 245.9 2967.6 12.1 0.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 474.0 3.4 0.0%
pet - ghoul energy
energy_regen energy 1809.6 11320.1 6.3 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.7 0.0 61.1sec 61.1sec 25% 25%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.4 0.0 48.2sec 48.2sec 61% 61%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.5 0.0 111.1sec 111.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.7 42.1 47.5sec 8.6sec 82% 82%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 47.9 0.0 9.3sec 9.3sec 38% 38%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.8 40.4 48.1sec 8.8sec 34% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 36.2 0.3 12.3sec 12.2sec 6% 6%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 88.8 258.1sec 5.0sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.8 62.6 196.1sec 5.7sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.05%
σ of the average dps 6.7246
2 * σ / μ 0.0502%
95% Confidence Intervall ( μ ± 2σ ) ( 26799.22 - 26826.12 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26792.50 - 26832.84 )
Sample Data
σ 672.4604
Minimum 24395.65
Maximum 29516.69
Spread ( max - min ) 5121.03
Range ( max - min ) / 2 2560.52
Range% 9.55
10th Percentile 25998.79
90th Percentile 27704.43
( 90th Percentile - 10th Percentile ) 1705.64
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2516
0.1 scale factor error with delta=300 4019
0.05 scale factor error with delta=300 16078
0.01 scale factor error with delta=300 401958
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQPPNP5NPPPMNKLMDLMPPPMMPLMPOPMPNPPMNPPQMRTKLPMMPPRPPPPMQNRRDNQOPPRPPPRPQRRPQRRPPPPURPNPPRPQROQRPPPRUAPPPRRDQNPQRRPPNPRPPO5PPRQURPQNQRPPNPPPPRPQRPQRURPOPNRDPPRPQRPQURP9PPRPPPPRBANOQPGQURPPPPPRPPRQPRNQDPPRUPPRORPQPNRQPPPRPPRSPPRUPQRPQNRP5PPOPPRPQRPRRQUDPPRRPPPRPRNQPRQPORUPRPPSPRBAPRQRPQRUPPPRPOPRDPRQPRQRPPNRPUPPRPPQRPTILPMPPRPPPRRPQRR9RUDQRPPPPPP5PPPBAGROQRUNPPQRPPPPRSPPRPQRPURQPPROPPRDPRQRPRQPNPPPMPPNPRPQRQNOPMPPPMPPNQMPRRUQDRPPPRPNAOPRUQPRQPRP7PPRRPPP5RUQPRQROPPPRDSPRPNPURQPRRQPRPRPPNPOPBARPQ9RPR

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7032 5662 4942
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.59% 18.59% 982
Spell Crit 9.56% 4.56% 818
Spell Haste 23.65% 17.76% 2274
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16866 12455 190
Melee Hit 8.18% 8.18% 982
Melee Crit 12.52% 5.13% 818
Melee Haste 35.42% 17.76% 2274
Expertise 16.12 16.12 484
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.26% 14.26% 1123

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 1
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 0
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 1
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 3
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 1
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_2h_T11_372
origin="http://chardev.org/?profile=87453"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
glyphs=blood_boil/pestilence/antimagic_shell/horn_of_winter/blood_tap/raise_ally/scourge_strike/raise_dead/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs=sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
# Gear Summary # gear_strength=4942
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=484
# gear_hit_rating=982
# gear_crit_rating=818
# gear_haste_rating=2274
# gear_mastery_rating=1123
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_1h_T11_372 : 26144dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26143.7 11.65 / 0.04% 2914.3 9.0 9.1 runic_power 0.83% 47.4
Origin http://chardev.org/?profile=75143
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:17236|17008|10136|4477|3615|2692|1799|1683|757&chds=0,34473&chco=2459FF,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++17236++howling_blast,2459FF,0,0,15|t++17008++obliterate,C79C6E,1,0,15|t++10136++frost_strike,2459FF,2,0,15|t++4477++blood_strike,C79C6E,3,0,15|t++3615++plague_strike,C79C6E,4,0,15|t++2692++melee_main_hand,C79C6E,5,0,15|t++1799++melee,C79C6E,6,0,15|t++1683++melee_off_hand,C79C6E,7,0,15|t++757++melee,C79C6E,8,0,15&chtt=Death_Knight_Frost_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,15,12,11,10,10,6,5,3,3,2,2,1,1,0,0,0,0&chds=0,100&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,2459FF,C79C6E,2459FF,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|howling_blast|obliterate_offhand|melee_main_hand|frost_strike_offhand|melee_off_hand|frost_fever|blood_plague|claw|melee|blood_strike|blood_strike_offhand|razorice|plague_strike|melee|plague_strike_offhand|claw&chtt=Death_Knight_Frost_1h_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:XYcnz0rw575326762x1642xvz22zwux10vroqvywtqqtuutrpnnprsssrppqromlmnpsuvwwwwwwxyyxxwvvwwxwwvvuuvvvvvwwvuuuuttsssstttttttuvvurponnopppqrsttuvvvvvvvvvwwvvuuuvvvvuuttuuvwwvvvuvvvuuuuuuvvutrqppppppqqqrsstuvvvvwwwwwwwwvwwwwwvvvwwwwwwwwxxyyyyyyyxxxwwvusrqponnnnnoopppppppqrrrsstttuuuuuuvvvvvwwwwwwwwwwwwxxxxxxxwvutsrponmmmmmmnnnnooppqqqqrssstuuvvwwxxxyyyzzz00000111111112222221110zzzzyzzzzzz0000000111111222122222223333322222211111110zzzyxwwwvvuuuuuuuuuuuuuvvv&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Death_Knight_Frost_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz1223445557778766554320zyxwvussrrrqpppoooooonnnnmmmmmllllllkkkkkkjjjjiiihhhhgggfffeeeddccccbbbbbbbccccdddeeffggghhhiiiiihiihhhhhhhhhgggggfffffffeeeeeddddccccccccccbbcbccccbbccccccddddeeeefffffggghhhhhhiiiiijjjjkkkklllllllllllkkkkjjjjiiihhhhhggggggggggggggggfffffffeeeeeedddddddddeeeeeeeeedddddddddddddddeeefffghhiijjkkklllllllkkkkkjjjiiihhhhhhhhhhhgggggggffffffffgggghhiijjkkllmmmnnnnnnnnmmmlllkkkkjjjjjjjjjjkkkklllllmmmmmmmmmmmmmmmmmmmmmmmlmlllllllll&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26144|max=44771&chxp=1,1,58,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,1,5,6,11,8,17,26,27,39,49,89,103,156,198,225,282,350,421,440,500,522,598,582,565,571,592,521,503,473,398,351,306,258,197,136,123,97,78,48,37,29,21,13,10,7,6,3&chds=0,598&chbh=5&chxt=x&chxl=0:|min=23861|avg=26144|max=28188&chxp=0,1,53,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T11_372 26144
blood_plague 905 3.5% 20.9 33.56sec 19601 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2314 4837 17.0% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.88 20.88 149.19 149.19 0.0000 3.0000 409301
Direct Results Count Pct Average Min Max Total Damage
hit 20.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 123.8 82.99% 2314.20 1588 3785 286518
crit 25.4 17.01% 4837.23 3318 7911 122783

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 438 1.7% 31.0 14.68sec 6390 4477 5674 11691 16445 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.00 31.00 0.00 0.00 1.4273 0.0000 198084
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 88.09% 5673.52 3702 8084 154912
crit 3.7 11.91% 11691.30 7669 16445 43172

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_strike_offhand 274 1.0% 31.0 14.68sec 4003 0 3556 7328 10277 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.00 31.00 0.00 0.00 0.0000 0.0000 124096
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 88.14% 3556.02 2313 5126 97150
crit 3.7 11.86% 7327.76 4792 10277 26946

Action details: blood_strike_offhand

Static Values
  • id:66215
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:425.34
  • base_dd_max:425.34
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 6.5 72.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.48 6.48 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.5 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 324.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.86 1.86 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1269 4.9% 74.4 6.10sec 7712 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3220 6727 17.0% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.40 74.40 150.34 150.34 0.0000 3.0000 573792
Direct Results Count Pct Average Min Max Total Damage
hit 74.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 83.00% 3220.25 2184 5418 401810
crit 25.6 17.00% 6727.18 4565 11323 171982

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 4011 15.3% 125.0 3.58sec 14506 10136 10767 22177 35638 32.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.04 125.04 0.00 0.00 1.4311 0.0000 1813815
Direct Results Count Pct Average Min Max Total Damage
hit 84.1 67.23% 10767.37 7636 17300 905225
crit 41.0 32.77% 22176.84 15731 35638 908590

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
frost_strike_offhand 2515 9.6% 125.0 3.58sec 9094 0 6752 13904 22279 32.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.04 125.04 0.00 0.00 0.0000 0.0000 1137132
Direct Results Count Pct Average Min Max Total Damage
hit 84.1 67.26% 6752.00 4775 10815 567820
crit 40.9 32.74% 13904.42 9836 22279 569312

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:runic_power
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:139.53
  • base_dd_max:139.53
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 3142 12.0% 68.6 6.56sec 20712 17236 18143 37947 63669 14.7% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.61 68.61 0.00 0.00 1.2016 0.0000 1420960
Direct Results Count Pct Average Min Max Total Damage
hit 57.2 83.43% 18142.56 12175 31515 1038413
crit 10.1 14.69% 37947.37 25446 63669 382547
miss 1.3 1.88% 0.00 0 0 0

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2690 10.3% 294.0 1.54sec 4138 2692 4710 9702 14326 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.96 293.96 0.00 0.00 1.5367 0.0000 1216251
Direct Results Count Pct Average Min Max Total Damage
hit 132.9 45.22% 4710.47 3408 7170 626112
crit 35.1 11.94% 9702.10 7021 14326 340500
glance 70.7 24.04% 3532.44 2556 5378 249638
miss 55.3 18.80% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1681 6.4% 293.3 1.54sec 2592 1683 2948 6073 9082 11.9% 18.7% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.33 293.33 0.00 0.00 1.5399 0.0000 760251
Direct Results Count Pct Average Min Max Total Damage
hit 133.0 45.34% 2948.49 2130 4481 392117
crit 35.0 11.93% 6072.84 4388 9082 212508
glance 70.4 23.99% 2211.53 1598 3361 155627
miss 55.0 18.74% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4445 17.0% 82.9 5.46sec 24240 17008 17131 35585 53914 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.92 82.92 0.00 0.00 1.4252 0.0000 2010030
Direct Results Count Pct Average Min Max Total Damage
hit 51.0 61.48% 17131.47 12282 26908 873304
crit 31.9 38.52% 35585.20 25300 53914 1136727

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
obliterate_offhand 2786 10.7% 82.9 5.46sec 15192 0 10740 22301 34644 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.92 82.92 0.00 0.00 0.0000 0.0000 1259699
Direct Results Count Pct Average Min Max Total Damage
hit 51.0 61.50% 10740.33 7676 16818 547686
crit 31.9 38.50% 22301.28 15813 34644 712013

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% offhand weapon damage plus a bonus. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:325.19
  • base_dd_max:325.19
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.2 67.10sec 0 0 0 0 0 0.0% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.22 7.22 0.00 0.00 1.2004 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.1 98.09% 0.00 0 0 0
miss 0.1 1.91% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.83 7.83 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 79 0.3% 6.9 65.97sec 5182 3615 4590 9468 14173 12.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 1.4333 0.0000 35748
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 87.87% 4590.31 3547 6880 27823
crit 0.8 12.13% 9467.90 7307 14173 7925

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 49 0.2% 6.9 65.97sec 3240 0 2876 5931 8857 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 0.0000 0.0000 22348
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.08% 2875.56 2216 4300 17472
crit 0.8 11.92% 5930.74 4566 8857 4876

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% offhand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:210.42
  • base_dd_max:210.42
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
razorice 254 1.0% 484.2 0.93sec 238 0 238 0 338 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.21 484.21 0.00 0.00 0.0000 0.0000 115025
Direct Results Count Pct Average Min Max Total Damage
hit 484.2 100.00% 237.55 179 338 115025

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:949.00
  • base_dd_max:1764.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
pet - army_of_the_dead_ghoul_8 1295
claw 559 43.1% 12.0 3.09sec 1630 0 1491 2983 2983 9.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 19561
Direct Results Count Pct Average Min Max Total Damage
hit 10.9 90.70% 1491.43 1491 1491 16233
crit 1.1 9.30% 2982.86 2983 2983 3327

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 737 56.9% 21.0 1.62sec 1228 757 1189 2379 2379 9.2% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 21.00 0.00 0.00 1.6225 0.0000 25781
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 66.89% 1189.27 1189 1189 16707
crit 1.9 9.20% 2378.55 2379 2379 4597
glance 5.0 23.90% 891.95 892 892 4477

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1658
claw 942 56.8% 105.8 3.83sec 3653 0 3344 6690 8749 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
105.81 105.81 0.00 0.00 0.0000 0.0000 386494
Direct Results Count Pct Average Min Max Total Damage
hit 96.1 90.78% 3344.26 2385 4374 321224
crit 9.8 9.22% 6689.93 4770 8749 65270

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 716 43.2% 124.5 3.23sec 2362 1799 2289 4578 5847 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.53 124.53 0.00 0.00 1.3128 0.0000 294118
Direct Results Count Pct Average Min Max Total Damage
hit 83.2 66.83% 2289.11 1628 2923 190493
crit 11.4 9.17% 4577.70 3257 5847 52300
glance 29.9 24.00% 1717.29 1221 2192 51325

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_1h_T11_372
frost_strike runic_power 98.6% 453.3 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.8 40
pet - ghoul
claw energy 100.0% 91.3 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 88.9 0.0 1.7%
chill_of_the_grave runic_power 150.2 1472.6 9.8 2.0%
frost_presence runic_power 126.1 197.8 1.6 0.8%
horn_of_winter runic_power 3.0 29.8 10.0 0.0%
improved_frost_presence runic_power 21.6 14.3 0.7 0.2%
rune_abilities runic_power 147.7 2321.7 15.7 1.4%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 392.2 2.8 0.0%
pet - ghoul energy
energy_regen energy 668.1 3980.5 6.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.7 0.0 54.8sec 54.8sec 28% 28%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
frost_presence 2.0 0.0 51.4sec 51.4sec 89% 86%

Database details

  • id:
  • cooldown name:buff_frost_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 395.0sec 395.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.7sec 104.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 49.0 2.7 9.2sec 8.7sec 13% 23%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.7sec 61.7sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 52.5 22.1 8.6sec 6.0sec 34% 76%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_razorice 1.0 483.2 0.0sec 0.9sec 100% 100%

Database details

  • id:
  • cooldown name:buff_rune_of_razorice
  • tooltip:(null)
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rune_of_the_fallen_crusader 10.8 31.2 42.6sec 10.6sec 75% 75%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.5 21.8 125.9sec 17.6sec 92% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 11% 12%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 54.1 8.2sec
runic_empowerment_wasted 2.1 100.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.43%
σ of the average dps 5.8274
2 * σ / μ 0.0446%
95% Confidence Intervall ( μ ± 2σ ) ( 26132.00 - 26155.31 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26126.18 - 26161.14 )
Sample Data
σ 582.7369
Minimum 23860.80
Maximum 28188.09
Spread ( max - min ) 4327.29
Range ( max - min ) / 2 2163.65
Range% 8.28
10th Percentile 25434.81
90th Percentile 26909.68
( 90th Percentile - 10th Percentile ) 1474.87
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1987
0.1 scale factor error with delta=300 3018
0.05 scale factor error with delta=300 12074
0.01 scale factor error with delta=300 301850
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
3 presence,choose=unholy,if=buff.bloodlust.react
4 army_of_the_dead
5 snapshot_stats
6 blood_fury,time>=10
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 pillar_of_frost
A raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
B raise_dead,time>=15
C outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
D howling_blast,if=dot.frost_fever.remains<=2
E plague_strike,if=dot.blood_plague.remains<=2
F obliterate,if=frost=2&unholy=2
G obliterate,if=death=2
H obliterate,if=buff.killing_machine.react
I blood_tap,if=buff.killing_machine.react
J empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
K blood_strike,if=blood=2
L frost_strike,if=runic_power>=90&!buff.bloodlust.react
M frost_strike,if=runic_power>=95
N howling_blast,if=buff.rime.react
O howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
P obliterate
Q empower_rune_weapon,if=target.time_to_die<=45
R frost_strike
S howling_blast
T blood_tap
U blood_strike,if=death=0
V empower_rune_weapon
W horn_of_winter

Sample Sequence

0124789C3FKNPNRAKH6MNPMGMNRPNKMPMNPMPMRPEMNRRTKPNPLNRPNPLNLRVFKLNPLNRPK9LRR2PCNKPNLRHGLNRORPKRRUPRPNREPNLKRRPNIGRRPRUWR9UR6PCNRPRSPNRPNRPNLKRRPNRUPNELORPNLPLROPI9LRBURPRUWCPNPLNOLHLNPLOLHKLNRPNKLEOLRPRRP9RTKPR6PNRKPLNHLNCPLNLPLNHLOLKRHOLPKLPLNELPLNRRT9URPNRPNROORPNKRPCELNRHNPLRROPNRKRRPNRUSRHEBR69RSORTPNRVFKLPLNHKLNPLNLCPLNHKLLNPLGGLLNPLNRR9REORKTGNPLRWRUPRPROORURPRCPNRUPNOLRRKP7ORROW69RPNRUEHRRIGRPNRSRUPNRPRKPRRSRCHRWUH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6983 5625 4957
Agility 721 138 20
Stamina 7574 5955 5780
Intellect 55 53 20
Spirit 85 85 20
Health 148991 126395 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 15.11% 15.11% 626
Spell Crit 13.79% 8.79% 1576
Spell Haste 17.66% 12.06% 1544
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16756 12380 190
Melee Hit 8.21% 8.21% 626
Melee Crit 16.75% 9.36% 1576
Melee Haste 12.06% 12.06% 1544
Expertise 26.91 26.91 808
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.94% 12.94% 886

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
tabard empty

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 3
Lichborne 0
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 3
Might of the Frozen Wastes 0
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_1h_T11_372
origin="http://chardev.org/?profile=75143"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
actions+=/presence,choose=unholy,if=buff.bloodlust.react
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
# Gear Summary # gear_strength=4957
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=808
# gear_hit_rating=626
# gear_crit_rating=1576
# gear_haste_rating=1544
# gear_mastery_rating=886
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_razorice

Death_Knight_Frost_2h_T11_372 : 25763dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25763.4 13.75 / 0.05% 2032.3 12.7 12.8 runic_power 7.41% 58.9
Origin http://chardev.org/?profile=61432
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://2.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:32462|20447|16797|8782|7308|3767|1776|854&chds=0,64923&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32462++obliterate,C79C6E,0,0,15|t++20447++frost_strike,2459FF,1,0,15|t++16797++howling_blast,2459FF,2,0,15|t++8782++blood_strike,C79C6E,3,0,15|t++7308++plague_strike,C79C6E,4,0,15|t++3767++melee_main_hand,C79C6E,5,0,15|t++1776++melee,C79C6E,6,0,15|t++854++melee,C79C6E,7,0,15&chtt=Death_Knight_Frost_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:32,26,15,11,4,3,3,3,3,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|claw|blood_strike|blood_plague|melee|plague_strike|melee|claw&chtt=Death_Knight_Frost_2h_T11_372+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:Tny782uu142ywx120ywxywuuvwvtssvxuqmoqqqooonppnmllknmmkkijkkljfdefikkkjjkjjjiihihggffefefeecdcdccbbcabaaZZXYXYYYYXYXYYZYYXVTTTTUUUVWYabbaaaaaaaZZYZZZZYYXYYZYYXXXXYXYYYWXWXWWWWVWXXXWXVVUTTTTTUVXXYXYYZbcccbaaabaaZZZZZZaZZYYXYYYYYXXYYZZZXXWXXXXWWWVUUTTSTTUVVWVWVWXXXXYYZZaaaZZZZZZZZYYYYZYZYYYYYYYYYXYYZZZYXWWWVUTTSSTUUUUUVVWWXWWWXWXXYZZaaaabaaZaaabaaabbcddddeeffgggghiiiiihgfffffffffffffeedededddcccdeeeeeeeeeddddddccccbbbbbbbaaaaZZYXXWWVVUUUUVVVVWVWWWWWWX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=106&chtt=Death_Knight_Frost_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:xy0012334547687777666543210zyxvvuuttssrrrqrqqqqpppppppooooooooooonnnnmmmmllllkkjjjiihhhggffefeeeeeeeeeeeeeeffgfggggghhhhhhhhiiiijjjjjkjkjjjjjjjiiihhhggfffeeeedddddddddddddcdcccdcdddeeefffffgghhiijjjkkkkkkkkklllklklllllllllllllllllllkkkkjjjjjjjjjjjijijiiiiiiiiiiihihhhhhggggggggfgfffffffffffffeeeeeeeeeeeeeeffffggghhiijijjjjkkkkkkkkkkkkkkkkllllllllllllllkkkkkkkkkkllllmmmnnooppqqqqrrrrqqqqppoooonnnnnmmmmmmmnnnnnnnnnnnnmmmmmllllllllklllllllmlmmmmmmnnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25763|max=41825&chxp=1,1,62,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,0,1,4,5,14,21,32,45,69,100,121,171,241,262,339,424,453,549,574,674,637,653,603,590,576,503,443,405,326,269,241,166,144,109,90,42,32,23,22,15,5,3,1,1,0,1&chds=0,674&chbh=5&chxt=x&chxl=0:|min=22947|avg=25763|max=28512&chxp=0,1,51,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T11_372 25763
blood_plague 786 3.1% 14.2 33.15sec 25111 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2117 4424 11.5% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.16 14.16 149.27 149.27 0.0000 3.0000 355599
Direct Results Count Pct Average Min Max Total Damage
hit 14.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 132.1 88.51% 2117.24 1600 3431 279713
crit 17.2 11.49% 4423.96 3344 7170 75886

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 789 3.1% 40.2 11.29sec 8871 8782 8308 17113 23664 6.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.23 40.23 0.00 0.00 1.0101 0.0000 356824
Direct Results Count Pct Average Min Max Total Damage
hit 37.6 93.51% 8308.14 6093 11487 312491
crit 2.6 6.44% 17113.08 12551 23664 44333
miss 0.0 0.05% 0.00 0 0 0

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 7.2 64.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.20 7.20 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.2 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.95 1.95 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1023 4.0% 82.2 5.52sec 5630 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2736 5722 11.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.21 82.21 150.35 150.35 0.0000 3.0000 462824
Direct Results Count Pct Average Min Max Total Damage
hit 82.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.1 88.54% 2736.19 2067 4447 364229
crit 17.2 11.46% 5722.42 4321 9295 98595

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 8155 31.7% 179.2 2.51sec 20585 20447 15365 31619 47898 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
179.15 179.15 0.00 0.00 1.0067 0.0000 3687768
Direct Results Count Pct Average Min Max Total Damage
hit 121.5 67.79% 15364.90 12355 23251 1866068
crit 57.6 32.16% 31618.65 25451 47898 1821699
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 2803 10.9% 74.9 5.96sec 16922 16797 15355 32053 54048 9.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.90 74.90 0.00 0.00 1.0074 0.0000 1267372
Direct Results Count Pct Average Min Max Total Damage
hit 67.9 90.62% 15355.08 11512 25860 1042132
crit 7.0 9.38% 32052.93 24061 54048 225239

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3761 14.6% 223.2 2.03sec 7622 3767 7563 15578 22335 6.4% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
223.15 223.15 0.00 0.00 2.0232 0.0000 1700814
Direct Results Count Pct Average Min Max Total Damage
hit 155.1 69.48% 7562.64 6202 10842 1172603
crit 14.4 6.44% 15577.57 12775 22335 224009
glance 53.6 24.03% 5673.75 4651 8132 304203
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 6760 26.2% 93.2 4.86sec 32803 32462 24397 50735 74903 32.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
93.20 93.20 0.00 0.00 1.0105 0.0000 3057124
Direct Results Count Pct Average Min Max Total Damage
hit 63.4 67.99% 24396.64 19728 36361 1545815
crit 29.8 31.96% 50734.97 40639 74903 1511308
miss 0.0 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.32 7.32 0.00 0.00 1.0142 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.84 7.84 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 112 0.4% 6.8 66.52sec 7378 7308 6904 14221 20756 6.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.85 6.85 0.00 0.00 1.0096 0.0000 50527
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 93.43% 6904.00 6046 10076 44175
crit 0.4 6.52% 14221.49 12455 20756 6351
miss 0.0 0.05% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 1445
claw 604 41.8% 13.0 2.78sec 1626 0 1491 2983 2983 9.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21143
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.77% 1491.43 1491 1491 17600
crit 1.2 9.14% 2982.86 2983 2983 3543
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 841 58.2% 24.0 1.44sec 1227 854 1189 2379 2379 9.2% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 29443
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.66% 1189.27 1189 1189 19026
crit 2.2 9.24% 2378.55 2379 2379 5278
glance 5.8 24.01% 891.95 892 892 5139
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1608
claw 897 55.8% 110.0 3.69sec 3351 0 3071 6147 7643 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.02 110.02 0.00 0.00 0.0000 0.0000 368640
Direct Results Count Pct Average Min Max Total Damage
hit 99.8 90.74% 3071.30 2184 3822 306619
crit 10.1 9.17% 6146.51 4368 7643 62021
dodge 0.0 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 712 44.2% 135.3 2.98sec 2162 1776 2097 4194 5107 9.2% 0.1% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
135.32 135.32 0.00 0.00 1.2173 0.0000 292541
Direct Results Count Pct Average Min Max Total Damage
hit 90.2 66.66% 2097.33 1499 2553 189190
crit 12.4 9.19% 4193.81 2998 5107 52150
glance 32.6 24.06% 1572.59 1124 1915 51200
dodge 0.1 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_2h_T11_372
frost_strike runic_power 100.0% 643.3 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 83.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 89.6 0.0 0.9%
chill_of_the_grave runic_power 168.0 1657.0 9.9 1.4%
horn_of_winter runic_power 11.4 114.5 10.0 0.0%
improved_frost_presence runic_power 185.7 113.0 0.6 0.4%
might_of_the_frozen_wastes runic_power 100.5 990.9 9.9 1.4%
power_refund runic_power 0.1 2.5 28.8 0.0%
rune_abilities runic_power 185.7 2811.8 15.1 0.9%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 443.0 3.2 0.0%
pet - ghoul energy
energy_regen energy 668.4 4164.2 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.2 0.0 58.1sec 58.1sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 108.2sec 108.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 67.5 3.0 6.7sec 6.4sec 15% 25%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.7sec 61.7sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 40.3 1.5 11.1sec 10.7sec 15% 54%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 7.4 61.3 61.8sec 6.5sec 90% 89%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.0 26.9 140.3sec 14.9sec 94% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 78.8 5.7sec
runic_empowerment_wasted 1.7 104.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.84%
σ of the average dps 6.8737
2 * σ / μ 0.0534%
95% Confidence Intervall ( μ ± 2σ ) ( 25749.69 - 25777.18 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25742.81 - 25784.05 )
Sample Data
σ 687.3674
Minimum 22946.89
Maximum 28512.29
Spread ( max - min ) 5565.40
Range ( max - min ) / 2 2782.70
Range% 10.80
10th Percentile 24912.11
90th Percentile 26682.11
( 90th Percentile - 10th Percentile ) 1770.00
Approx. Iterations needed for
1% dps error 28
0.1% dps error 2847
0.1 scale factor error with delta=300 4199
0.05 scale factor error with delta=300 16799
0.01 scale factor error with delta=300 419976
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J blood_strike,if=blood=2
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T blood_strike,if=death=0
U empower_rune_weapon
V horn_of_winter

Sample Sequence

0123678BEJMOLLMJL5OLOLFAGLLMOLQOMLJQQOQQRDJQOMHFLGKKMOKKQOQNQQJTUEFFKKMQ8QOBJKMQOQOJKQRQNQVOMQQNQTQOMQOQTHDQNQVTGMQOMKQQOMQTQO8MQVQOQN5BQTGQTQOOMQQOMQOQVQTSOMOKDMQQTOQQOMQQTOMQOQQR8QQOQTRNQQVAGBMOKMQQTNQOMQQNQOQTVQRNQOQSFQNQODQNQTNQOQTQVOMQ8QOMQNN5QOMJKQOMQQTOBQNQVQTGMQNQOMQOKNQOKNQHJGKQQOMQODNKQQVQGNQQ8TQTGMQOQQOMOKMQQTOMOKBMKQOOMOKQQJOMNKQQJOOQQNQSRQOQOMQUEDJKGK8KQOQ5JQQRAVOQRQQOQTTQNQROMBQQOOMQQOQQOQJTVQOMOKMQQOMNQQOQHGQ8QDVQTNQTQOMOQQOQNQVOQQOMBNJKQQOMNKJQQONKQQOMQVGQ6OQHJQ8QO5OQTQDRQNTQVQONQQTOQNOMKQQRQOMQVTQGBGMKQJQOMOKQQOQTO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 8.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16895 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01% 15.01% 1257

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_2h_T11_372
origin="http://chardev.org/?profile=61432"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard=tabard_of_ramkahen,ilevel=85
# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T11_372 : 26477dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26476.7 11.27 / 0.04% 21.8 1212.2 1199.5 mana 0.00% 41.4
Origin http://chardev.org/?profile=34049
Talents http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
Glyphs
  • focus
  • rebirth
  • starfall
  • mark_of_the_wild
  • unburdened_rebirth
  • dash
  • starsurge
  • insect_swarm
  • moonfire

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:88680|83207|74976|43286|41436|16979|16072|1930&chds=0,177360&chco=336600,69CCF0,69CCF0,336600,8AD0B1,69CCF0,336600,C79C6E&chm=t++88680++sunfire,336600,0,0,15|t++83207++moonfire,69CCF0,1,0,15|t++74976++starfall,69CCF0,2,0,15|t++43286++insect_swarm,336600,3,0,15|t++41436++starsurge,8AD0B1,4,0,15|t++16979++starfire,69CCF0,5,0,15|t++16072++wrath,336600,6,0,15|t++1930++treant_melee,C79C6E,7,0,15&chtt=Druid_Balance_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:24,23,16,12,11,7,6,1,0,0&chds=0,100&chco=336600,69CCF0,8AD0B1,69CCF0,336600,336600,69CCF0,C79C6E,336600,C41F3B&chl=wrath|starfire|starsurge|moonfire|insect_swarm|sunfire|starfall|treant_melee|wild_mushroom_detonate|darkmoon_card_volcano&chtt=Druid_Balance_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:n00zzyxxw05777665443100zzyyxxyz0zyxwvvuttttssssstvxyzzzzzyyxxxwwwvvvuutuuuuvwxyyxxwwvvuuttttsssstuvwxxyyyyyyyxxxwwvvvuuuuuuvvwwwwwwwwvvvuutttsssssttuvwxxyyyxxxwwwwvvuuuutttuuvvwwwwwwvvuutsssrrrrssstttuvvvvvvvvuuuttsssssrssssttuuuuuuuttsssrrrrrrrrssttttuuuuuuutttsssrrrrrrrrrssstttttttttsssrrrrrrrsssttttttttttttsssrrrrrrrrrrrssstttuuuuttttssssssssttttuuuuuuuttttsssrrrqqqqrrsssttuuuuuuuuttttttttttttttuuuutttttssssrrrrrrsssttuuvvvvvvvvvuuuuuutttttttuuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=121191&chtt=Druid_Balance_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:wy34566665555774242345421zyxxwwuuutttssrrponmlmnmmmlmlmmmmmmlljjiiihgfffffffffeeffghhgggggggghhhhhhiijjjkkkkklllkkkjiijjjjjjjjjjjjjjjjjjjjjjiiiiiihhhhggfggggggffffeeeeedddeefgghhijjklllllllmmmmmmmlllkkjjjjiiijjjjjiijjjjjjjjjkklmmnnnooonnmmllkkkkjjihhggffeeeddddddddddddeeffggghiijkkllllllkkkjjihhhhggffffeeeeeeeeeffgghiijkllmnnoooooppppoonnmlkjjihgggffffffffffffgggghhijkllmmnnooooooonnnnnmlkkjiihggfffeeeeeeeffffgghhijjklmnnoopppqqpppoonnmmllkkjiihhgg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26477|max=43454&chxp=1,1,61,100&chtt=Druid_Balance_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,5,6,4,16,24,33,49,56,80,112,170,158,244,313,370,400,459,498,556,550,560,559,565,517,518,483,410,363,354,330,265,230,167,140,99,78,68,47,44,31,27,17,7,5,1,2,4,2&chds=0,565&chbh=5&chxt=x&chxl=0:|min=24578|avg=26477|max=28616&chxp=0,1,47,100&chtt=Druid_Balance_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Balance_T11_372 26477
darkmoon_card_volcano 71 0.3% 10.2 46.40sec 3142 0 2681 4151 4884 31.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.22 10.22 0.00 0.00 0.0000 0.0000 32124
Direct Results Count Pct Average Min Max Total Damage
hit 7.0 68.41% 2681.05 2568 3161 18750
crit 3.2 31.52% 4151.04 3968 4884 13373
miss 0.0 0.07% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
insect_swarm 2854 10.8% 26.0 17.75sec 49665 43286 0 0 0 0.0% 0.1% 0.0% 0.0% 304 3415 5203 46.1% 0.0% 99.7%

Stats details: insect_swarm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.99 25.99 304.46 304.46 1.1474 1.4810 1290628
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 99.92% 0.00 0 0 0
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.2 53.93% 3415.49 2428 6467 560851
crit 140.2 46.07% 5203.46 3752 9992 729776

Action details: insect_swarm

Static Values
  • id:5570
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1490.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:$w1 Nature damage every $t1 sec.
  • description:The enemy target is swarmed by insects, causing $o1 Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:136.15
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
moonfire 3156 11.9% 15.3 30.23sec 93055 83207 4234 8932 15653 34.6% 0.1% 0.0% 0.0% 193 4606 9404 48.2% 0.0% 59.2%

Stats details: moonfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.34 15.34 193.30 193.30 1.1184 1.3852 1427438
Direct Results Count Pct Average Min Max Total Damage
hit 10.0 65.33% 4233.60 2831 7489 42425
crit 5.3 34.60% 8931.86 5918 15653 47405
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.1 51.77% 4605.50 2960 8065 460887
crit 93.2 48.23% 9404.05 6186 16856 876721

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional ${$m1*6*$} Arcane damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 1640 6.2% 8.9 49.79sec 83679 74976 0 0 0 0.0% 0.0% 0.0% 0.0% 87 6401 13513 29.3% 0.1% 19.3%

Stats details: starfall

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.87 8.87 87.46 87.46 1.1161 1.0000 741820
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.7 70.59% 6401.30 4178 10875 395192
crit 25.7 29.33% 13513.32 8732 22730 346628
miss 0.1 0.08% 0.00 0 0 0

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
  • description:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.247000
  • base_dd_min:368.70
  • base_dd_max:428.49

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • tree:balance
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6522.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
starfire 5963 22.5% 81.9 5.43sec 32922 16979 20784 48219 81985 44.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.91 81.91 0.00 0.00 1.9390 0.0000 2696778
Direct Results Count Pct Average Min Max Total Damage
hit 45.6 55.63% 20784.15 14768 39227 947134
crit 36.3 44.30% 48219.35 30865 81985 1749644
miss 0.1 0.07% 0.00 0 0 0

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:986.98
  • base_dd_max:1230.95
starsurge 4282 16.2% 37.4 12.12sec 51728 41436 33098 76093 124966 43.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.43 37.32 0.00 0.00 1.2484 0.0000 1936336
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 56.16% 33097.95 22394 59792 693674
crit 16.3 43.76% 76093.21 46804 124966 1242663
miss 0.0 0.08% 0.00 0 0 0

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.535000
  • base_dd_min:1272.16
  • base_dd_max:1756.79
sunfire 1744 6.6% 7.9 57.07sec 100143 88680 4977 10492 15653 34.1% 0.1% 0.0% 0.0% 96 5327 11242 38.8% 0.0% 30.7%

Stats details: sunfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.88 7.88 96.38 96.38 1.1293 1.4422 788664
Direct Results Count Pct Average Min Max Total Damage
hit 5.2 65.85% 4977.44 4352 7489 25815
crit 2.7 34.08% 10492.40 9096 15653 28158
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 59.0 61.19% 5327.45 4549 8065 314204
crit 37.4 38.81% 11242.07 9508 16856 420487

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional ${$m1*4*$} Nature damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 82 0.3% 1.0 0.00sec 37190 0 31949 49361 49361 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 37190
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 69.70% 31948.58 31949 31949 22268
crit 0.3 30.23% 49360.55 49361 49361 14922
miss 0.0 0.07% 0.00 0 0 0

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.603200
  • base_dd_min:845.04
  • base_dd_max:1022.45
wrath 6299 23.8% 121.5 3.60sec 23440 16072 15276 34641 58192 42.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.53 121.16 0.00 0.00 1.4585 0.0000 2848731
Direct Results Count Pct Average Min Max Total Damage
hit 69.5 57.34% 15276.24 10437 27843 1061181
crit 51.6 42.59% 34641.45 21813 58192 1787551
miss 0.1 0.07% 0.00 0 0 0

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]$?s33891[ |C0033AA11Tree of Life: Cast time reduced by 50%, damage increased by 30%.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:675.17
  • base_dd_max:761.36
pet - treants 450
treant_melee 450 100.0% 60.8 6.39sec 2862 1930 3038 6056 7514 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: treant_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
60.77 60.77 0.00 0.00 1.4828 0.0000 173908
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 75.77% 3038.27 2755 3757 139907
crit 0.1 0.21% 6056.11 5510 7514 765
glance 14.6 23.99% 2279.59 2066 2818 33236
dodge 0.0 0.03% 0.00 0 0 0

Action details: treant_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.65
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Druid_Balance_T11_372
insect_swarm mana 6.9% 34.4 1445
moonfire mana 4.6% 57.2 1627
starfall mana 10.2% 13.2 6326
starfire mana 26.1% 18.8 1750
starsurge mana 12.3% 28.7 1800
sunfire mana 2.3% 61.6 1627
wrath mana 33.6% 15.4 1517
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29086.1 16.1 1.4%
euphoria mana 18.6 349851.4 18786.4 3.8%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101725.0 101725.0 0.0%
innervate mana 14.5 20888.3 1441.6 23.2%
mp5_regen mana 1809.6 83061.4 45.9 1.4%
omen_of_clarity none 21.5 41043.3 1907.6 0.0%
replenishment mana 1809.6 53736.0 29.7 1.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.2sec 104.2sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 220.3 0.0 2.0sec 2.0sec 78% 78%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
innervate 0.4 0.0 226.0sec 226.0sec 1% 100%

Database details

  • id:
  • cooldown name:buff_innervate
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.3sec 52.3sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
lunar_eclipse 9.1 0.0 49.4sec 49.4sec 27% 55%

Database details

  • id:48518
  • cooldown name:buff_lunar_eclipse
  • tooltip:Damage done by your arcane spells increased by $w1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_shower 23.2 0.0 19.9sec 19.9sec 15% 16%

Database details

  • id:81192
  • cooldown name:buff_lunar_shower
  • tooltip:Direct damage of your Moonfire increased by $s1%, and mana cost reduced by $s2%.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 19.4 0.0 23.9sec 23.9sec 63% 65%

Database details

  • id:
  • cooldown name:buff_natures_grace
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
omen_of_clarity 21.6 1.0 20.0sec 19.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
power_torrent_mh 10.1 0.0 47.1sec 47.1sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shooting_stars 22.0 1.7 19.9sec 18.5sec 9% 57%

Database details

  • id:93400
  • cooldown name:buff_shooting_stars
  • tooltip:Cast time of your next Starsurge reduced by $s1%.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:4.00%
solar_eclipse 9.6 0.0 48.7sec 48.7sec 31% 54%

Database details

  • id:48517
  • cooldown name:buff_solar_eclipse
  • tooltip:Damage done by your nature spells increased by $w1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_caster 18.6 0.0 24.4sec 24.4sec 24% 20%

Database details

  • id:
  • cooldown name:buff_t11_4pc_caster
  • tooltip:(null)
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
treants-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
moonkin_form

Database details

  • id:24858
  • cooldown name:buff_moonkin_form
  • tooltip:Arcane and Nature spell damage increased by $24905s3%. Immune to Polymorph effects. All damage reduced by $24905s1%. Spell haste of all party and raid members increased by $24907s1%
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
unaligned_eclipse_gain 0.3 152.1sec
wrong_eclipse_starfire 1.0 149.0sec
wrong_eclipse_wrath 3.4 98.2sec

Statistics & Data Analysis

DPS
Population
Convergence 71.28%
σ of the average dps 5.6341
2 * σ / μ 0.0426%
95% Confidence Intervall ( μ ± 2σ ) ( 26465.44 - 26487.97 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26459.80 - 26493.61 )
Sample Data
σ 563.4098
Minimum 24577.63
Maximum 28615.64
Spread ( max - min ) 4038.01
Range ( max - min ) / 2 2019.00
Range% 7.63
10th Percentile 25801.04
90th Percentile 27229.59
( 90th Percentile - 10th Percentile ) 1428.56
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1811
0.1 scale factor error with delta=300 2821
0.05 scale factor error with delta=300 11286
0.01 scale factor error with delta=300 282160
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 moonkin_form
4 snapshot_stats
5 volcanic_potion,if=!in_combat
6 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
7 faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
8 wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
9 berserking
A insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
B starsurge,if=buff.t11_4pc_caster.up
C starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
D wrath,if=buff.t11_4pc_caster.up
E wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
F wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
G typhoon,moving=1
H starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
I sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
J moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
K starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
L innervate,if=mana_pct<50
M treants,time>=5
N starfire,if=eclipse_dir=1&eclipse<80
O starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
P wrath,if=eclipse_dir=-1&eclipse>=-87
Q wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
R starfire,if=eclipse_dir=1
S wrath,if=eclipse_dir=-1
T starfire
U wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
V moonfire,moving=1
W sunfire,moving=1

Sample Sequence

013589AJKTNMNNNQDDBPPAPIPPPPPKPPPOCCACHJNKNNNNNADDDBDIPPPPAPPPPKPOBCHJKANNNNNNQBDIAKPPPPPPPPPPJABCCHNNNJNAKNNNQDDDPPAIKPPPPPPPPOAB9CHJNNMNNNNARQBDIPPKPPPAPPPPPJKSCCCAHNNJKNKNNNADBDPIPPPPPAPKPPPPJSCCAHKNNNJNNNNABDDPPPIPPPAPKPPPPPCCCHAJKNNNNNNNABDD9DIPPPMPPAPKPPPPJSCCACHKNNJNKNNARQDDDKIPPPAPPPPPPKSCCCAHJNNKNNNNARJDDBPKPPPAKPJPPPPPOCCAHKJNNNN6NNQABDPIPPPPPPPAKPPOCCH9JN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 699 117 20
Agility 693 111 20
Stamina 7588 5968 5862
Intellect 6013 5293 4595
Spirit 1765 1765 1591
Health 145435 122825 0
Mana 107575 97750 0
Spell Power 9031 7490 2207
Spell Hit 16.93% 16.93% 143
Spell Crit 24.46% 18.35% 778
Spell Haste 23.87% 17.97% 2301
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 1797 469 0
Melee Hit 1.19% 1.19% 143
Melee Crit 18.94% 12.15% 778
Melee Haste 17.97% 17.97% 2301
Expertise 0.00 0.00 0
Armor 14998 10922 10922
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 7.80% 5.41% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.35% 14.35% 1138

Gear

Encoded
head stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2 security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
tabard empty

Talents

Balance Rank
Nature's Grace 3
Starlight Wrath 3
Nature's Majesty 2
Genesis 3
Moonglow 1
Balance of Power 2
Euphoria 2
Moonkin Form 1
Typhoon 1
Shooting Stars 2
Owlkin Frenzy 0
Gale Winds 2
Solar Beam 0
Dreamstate 2
Force of Nature 1
Sunfire 1
Earth and Moon 1
Fungal Growth 0
Lunar Shower 3
Starfall 1
Feral Rank
Feral Swiftness 0
Furor 0
Predatory Strikes 0
Infected Wounds 0
Fury Swipes 0
Primal Fury 0
Feral Aggression 0
King of the Jungle 0
Feral Charge 0
Stampede 0
Thick Hide 0
Leader of the Pack 0
Brutal Impact 0
Nurturing Instinct 0
Primal Madness 0
Survival Instincts 0
Endless Carnage 0
Natural Reaction 0
Blood in the Water 0
Rend and Tear 0
Pulverize 0
Berserk 0
Restoration Rank
Blessing of the Grove 2
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 2
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Balance_T11_372
origin="http://chardev.org/?profile=34049"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
glyphs=focus/rebirth/starfall/mark_of_the_wild/unburdened_rebirth/dash/starsurge/insect_swarm/moonfire
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/moonkin_form
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
actions+=/berserking
actions+=/insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
actions+=/starsurge,if=buff.t11_4pc_caster.up
actions+=/starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
actions+=/wrath,if=buff.t11_4pc_caster.up
actions+=/wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/typhoon,moving=1
actions+=/starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
actions+=/sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
actions+=/moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
actions+=/starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
actions+=/innervate,if=mana_pct<50
actions+=/treants,time>=5
actions+=/starfire,if=eclipse_dir=1&eclipse<80
actions+=/starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
actions+=/wrath,if=eclipse_dir=-1&eclipse>=-87
actions+=/wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
actions+=/starfire,if=eclipse_dir=1
actions+=/wrath,if=eclipse_dir=-1
actions+=/starfire
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
actions+=/moonfire,moving=1
actions+=/sunfire,moving=1
head=stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
chest=scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist=belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs=stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet=nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists=manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands=stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2=security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5862
# gear_intellect=4595
# gear_spirit=1591
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=778
# gear_haste_rating=2301
# gear_mastery_rating=1138
# gear_armor=10922
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Druid_Feral_T11_372 : 25539dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25539.2 10.43 / 0.04% 1649.5 15.5 15.3 energy 47.27% 34.1
Origin http://chardev.org/?profile=35492
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:65859|33952|33451|21159|14008|4817&chds=0,131717&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++65859++rake,C55D54,0,0,15|t++33952++ferocious_bite,C79C6E,1,0,15|t++33451++ravage,C79C6E,2,0,15|t++21159++shred,C79C6E,3,0,15|t++14008++mangle_cat,C79C6E,4,0,15|t++4817++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:27,25,20,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|rake|cat_melee|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qviku47711zzvsqoonlkjihfecbZXWXemolhdbYWVUUUUTTSTTTTTTTTTSWcgfecaYWVVUUUUTTTSSSSTTTTTUYdggecaYXWVVUUUUTTTTSSSSSTTVYdeedbZXVUUUTTTTTTTTTTTSSSTVZcedcbZYWVUTTTTTTTUTTUUUTTUWadeedcaYXWVUUTTTTTTTTTTTTTUWacdddddeeedcbZYWVTSSRRSSSTUWYbccbaZXWWVVUUUUTTTTTTTTTUVYabcdcbZYXWVVUUUUUTTTTSSTTUVXZbccbaZXWVUUUTTTTTTTTTTSTUVXZabbaZYXWVUUUUTTTTTTTTTTTUWXZabbaZZXWVVUUTTTTTTTTTTTUUVXYZaaZZXWWVUUUTTTSSTTSSTTTUWXYZaaabbbbbaZXWVTSRRQRRRRSTVWXYYYYXWVVUUUTTTTTTSSSSSTTUVXXY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Druid_Feral_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qsuxyyyzz00124577765320zyxwwvvutrrppnnmlllkkjjhhggggggghhhiiijjjkjjjjjihhhggggghhhiiiiiijjjjjkkkkjiihgggggghhiiiiiiiiiiiiiiiiiihggfffffggghhhhhhhhhhhhhhihhhhggggggghhijjjjjjkjjjjjjjjjjiihhgggggghhiijjkllmmmnnnnooonnnnnnmmmllllllkkkkkjjjjiiihhhhhhhhiiiiiiiiijjjjjjjjiihhgggggghhhhiiiiiiiiiiijjiiihhggggggghhhiiiiiiiiiiijjjjiiihhhhhhiijjjkkkkkkkkkkkkkkjjjiiihhhiiiiijjjjjjjjjjjjjjiiiiiiiiiiijjkklmmnoppqqrrrrrrrrrrrrqqqqpppooonnnnmmmlllkjjjiiijiiiiiiiiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25539|max=41922&chxp=1,1,61,100&chtt=Druid_Feral_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,6,4,14,18,29,46,56,84,102,169,176,230,267,317,409,455,506,574,555,642,605,596,572,600,472,410,425,354,275,228,203,133,120,95,69,49,39,24,25,11,11,10,4,3,0,2,0,2&chds=0,642&chbh=5&chxt=x&chxl=0:|min=23764|avg=25539|max=27707&chxp=0,1,45,100&chtt=Druid_Feral_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372 25539
berserk 0 0.0% 2.8 195.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0164 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4814 18.9% 547.6 0.83sec 3977 4817 2921 6048 7505 49.5% 10.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.64 547.64 0.00 0.00 0.8255 0.0000 2177712
Direct Results Count Pct Average Min Max Total Damage
hit 85.8 15.67% 2921.29 1848 3643 250674
crit 270.9 49.46% 6047.65 3807 7505 1638106
glance 131.4 23.99% 2198.87 1386 2732 288931
dodge 35.7 6.51% 0.00 0 0 0
miss 23.9 4.37% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 860 3.4% 11.3 41.04sec 34584 33952 21256 44457 73912 67.3% 10.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.25 11.25 0.00 0.00 1.0186 0.0000 389108
Direct Results Count Pct Average Min Max Total Damage
hit 2.5 22.03% 21255.54 2968 35880 52695
crit 7.6 67.26% 44456.85 6107 73912 336414
dodge 0.7 6.46% 0.00 0 0 0
miss 0.5 4.25% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 949 3.7% 51.5 8.74sec 8326 0 6109 12632 15510 44.2% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.54 51.54 0.00 0.00 0.0000 0.0000 429077
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 44.95% 6108.62 5729 7529 141495
crit 22.8 44.18% 12631.66 11801 15510 287582
dodge 3.4 6.51% 0.00 0 0 0
miss 2.3 4.37% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 705 2.8% 22.2 20.68sec 14370 14008 10519 21699 25644 44.7% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.19 22.19 0.00 0.00 1.0258 0.0000 318805
Direct Results Count Pct Average Min Max Total Damage
hit 9.9 44.44% 10518.69 9610 12449 103704
crit 9.9 44.68% 21698.71 19797 25644 215101
dodge 1.4 6.47% 0.00 0 0 0
miss 1.0 4.41% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 5000 19.6% 33.5 13.52sec 67571 65859 1884 3895 4670 44.1% 10.9% 0.0% 0.0% 146 9727 20124 49.6% 0.0% 96.1%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.47 33.47 146.23 146.23 1.0260 2.9719 2261722
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 45.00% 1883.78 1778 2267 28377
crit 14.8 44.12% 3895.20 3663 4670 57525
dodge 2.2 6.51% 0.00 0 0 0
miss 1.5 4.36% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.8 50.44% 9726.65 9157 12018 717483
crit 72.5 49.56% 20123.96 18864 24756 1458337

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 75 0.3% 1.0 0.00sec 33753 33451 23012 47414 47613 54.4% 11.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0090 0.0000 33753
Direct Results Count Pct Average Min Max Total Damage
hit 0.3 34.65% 23012.29 20098 23113 7974
crit 0.5 54.37% 47414.48 41403 47613 25779
dodge 0.1 6.50% 0.00 0 0 0
miss 0.0 4.48% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6824 26.7% 17.1 23.13sec 180827 176411 0 0 0 0.0% 10.8% 0.0% 0.0% 212 9498 19650 49.8% 0.0% 93.8%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.07 17.07 212.15 212.15 1.0250 2.0000 3086714
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 89.23% 0.00 0 0 0
dodge 1.1 6.42% 0.00 0 0 0
miss 0.7 4.35% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 106.6 50.24% 9498.07 8719 11527 1012280
crit 105.6 49.76% 19650.10 17962 23746 2074434

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.96 13.96 0.00 0.00 1.0260 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6312 24.7% 132.0 3.37sec 21631 21159 15887 32849 39324 44.0% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
131.99 131.99 0.00 0.00 1.0223 0.0000 2855120
Direct Results Count Pct Average Min Max Total Damage
hit 59.5 45.09% 15886.52 15022 19089 945469
crit 58.1 44.04% 32848.79 30946 39324 1909651
dodge 8.6 6.48% 0.00 0 0 0
miss 5.8 4.38% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.49 16.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372
feral_charge_cat energy 0.1% 0.0 10
ferocious_bite energy 6.7% 832.6 42
mangle_cat energy 10.2% 446.5 32
rake energy 14.3% 2257.9 30
rip energy 6.5% 6748.1 27
savage_roar energy 4.8% 0.0 24
shred energy 57.4% 710.8 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 88.7 564.4 6.4 0.0%
energy_regen energy 1809.6 4984.3 2.8 0.1%
omen_of_clarity none 28.3 1087.0 38.4 0.0%
tigers_fury energy 16.5 989.6 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.7sec 195.7sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 39.7 136.7 11.5sec 2.6sec 78% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 56.1sec 56.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 28.4 0.3 15.5sec 15.4sec 3% 4%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.4sec 81.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.8sec 23.8sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.8 8.1 81.0sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:22.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 28.0sec 28.0sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 75.1 7.8sec
fury_swipes 51.5 8.7sec
primal_fury 83.4 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 71.46%
σ of the average dps 5.2162
2 * σ / μ 0.0408%
95% Confidence Intervall ( μ ± 2σ ) ( 25528.78 - 25549.64 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25523.56 - 25554.86 )
Sample Data
σ 521.6223
Minimum 23764.40
Maximum 27707.10
Spread ( max - min ) 3942.70
Range ( max - min ) / 2 1971.35
Range% 7.72
10th Percentile 24890.29
90th Percentile 26217.48
( 90th Percentile - 10th Percentile ) 1327.19
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1668
0.1 scale factor error with delta=300 2418
0.05 scale factor error with delta=300 9674
0.01 scale factor error with delta=300 241857
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBB9IJMRSSFSPSLSSKSSSSSSSIB9KMSSSSSSKSISS9BSKSMSSLSSISKSB9SSSSKIISSSMKS9BSSSIKSSSKS9BIISMSKSSNK9BSSISSKSSSSSS9BIJSSFLMSSSSSKSSSLSSSLISSB9SKSSNSLKISSB9SPKSSSSSISKMB9SLSSKKISSKMB9QSSSIKSSSNKSBS9IISSSSKSSSI9BJSSSMSKSIS9BKSSSSFSSSSSSSGKSMSS9BSHHHKSSSNLKSG9BSSSHKSSSNLKS9BGSSKSHSSK9BHASMSSKSSISB9KSHSMS

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7051 5457 5366
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 4.26% 4.26% 436
Spell Crit 20.56% 15.54% 2222
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 24067 829 190
Melee Hit 3.63% 3.63% 436
Melee Crit 51.57% 37.66% 2222
Melee Haste 3.97% 3.97% 508
Expertise 0.00 0.00 0
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.65% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.98% 19.98% 2148

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372
origin="http://chardev.org/?profile=35492"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5366
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=436
# gear_crit_rating=2222
# gear_haste_rating=508
# gear_mastery_rating=2148
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Druid_Feral_T11_372_hitcap : 25482dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25482.4 10.08 / 0.04% 1736.3 14.7 14.5 energy 49.14% 33.0
Origin http://chardev.org/?profile=35430
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:68596|35382|34963|22026|14532|4883&chds=0,137193&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++68596++rake,C55D54,0,0,15|t++35382++ferocious_bite,C79C6E,1,0,15|t++34963++ravage,C79C6E,2,0,15|t++22026++shred,C79C6E,3,0,15|t++14532++mangle_cat,C79C6E,4,0,15|t++4883++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372_hitcap+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,19,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|cat_melee|rake|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372_hitcap+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:nqdhv584uttsoligfedcaZYWWVVUSTUenmhbYWUTTSTTSSRRRSSRRSSSSRVdgdaYVUUTTSTTSSSRQRRRSSSSSTZefdaYWVUTTSSSSSSSSSRQRRSSSUZcdbZXWUSSSSSSSSSSSSSSRRRRSVZdcbZXWUTSRRRRSSSSSSSSTSSSTWbddcaYWVUTTSSRRRSSSSSSSSSSTWaccbaabccbaYXVTSRQPPPPQQRSTWZaaZYWVUUTTTTSSSSRRRRSSSSTVYabbaZXWVUTTTSSSSSSSRRRRRSTVXZaaZXWVUTSSSSSSSSSSSSRRRSTVYZaZYXWVUTSSSSSSSSSSSSSSSSUWYZZZYXWVUTTSSSRRRRSSSSSSSSUWXYZYXWVUUTTSSSRRRRRRRRRSSTUWXYYYYYZZZYXWUTSQQPOOOPPQRSUVWXXWVVUTTSSSSSSSSRRRRRRRSTUWXXX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=73&chtt=Druid_Feral_T11_372_hitcap+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwyzzzzz1023458764321zywwvvutsrqponmmllkkjjihggffgfggggghhiiiijjjjiiihggggffgghhhhhhhhiiijjjjjjjihggfffffgghhhhhhhhhhhhiiiiihhgfeeeeeffggghhhhggggggghhhhgggffffffghhiijjjjjjjjiiijjiihhgggfffffgghhijjklllmmmnnnnnnmmmmmmlllkkkkkjjjjjjjiihhhgggggghhhhhhhhhiiiiiiiiiihhggfffffgghhhhhhhhhhhhiiiiihhggffffffggghhhhhhhhhhhiiiiiihhhgggghhiijjjjkkkkjjjjjjjjjiihhhgghhhhhiiiijjjjjjiiiiiihhhhhhhhhiijjkklmnooppqqqqqqqqqqqqqqpppoonnnmmmmlllllkjjiihhhiiiiiiiiijjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25482|max=42640&chxp=1,1,60,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,2,5,13,13,38,47,65,95,139,189,242,291,421,457,489,594,637,698,615,639,648,630,545,501,429,360,275,240,166,153,101,97,53,42,21,14,6,10,9,2,2,1,0,1,0,0,0,1&chds=0,698&chbh=5&chxt=x&chxl=0:|min=23713|avg=25482|max=27951&chxp=0,1,42,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372_hitcap 25482
berserk 0 0.0% 2.8 195.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.77 2.77 0.00 0.00 1.0171 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4880 19.2% 547.7 0.83sec 4030 4883 2920 6038 7485 44.8% 3.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.72 547.72 0.00 0.00 0.8254 0.0000 2207496
Direct Results Count Pct Average Min Max Total Damage
hit 149.5 27.30% 2919.55 1843 3633 436528
crit 245.5 44.83% 6037.81 3796 7485 1482478
glance 131.4 24.00% 2194.78 1382 2725 288490
dodge 21.2 3.88% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 870 3.4% 10.9 43.50sec 36066 35382 21063 44378 73687 67.8% 3.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.91 10.91 0.00 0.00 1.0193 0.0000 393594
Direct Results Count Pct Average Min Max Total Damage
hit 3.1 28.45% 21062.97 2957 35770 65407
crit 7.4 67.76% 44378.39 6086 73687 328187
dodge 0.4 3.78% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 1040 4.1% 54.3 8.29sec 8663 0 6092 12595 15468 43.2% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.31 54.31 0.00 0.00 0.0000 0.0000 470447
Direct Results Count Pct Average Min Max Total Damage
hit 28.8 52.95% 6092.04 5712 7509 175166
crit 23.4 43.17% 12595.20 11766 15468 295282
dodge 2.1 3.88% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 669 2.6% 20.2 22.87sec 14952 14532 10483 21625 25582 43.8% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 0.00 0.00 1.0289 0.0000 302473
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 52.26% 10483.02 9586 12419 110833
crit 8.9 43.81% 21625.22 19746 25582 191641
dodge 0.8 3.93% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4863 19.1% 31.2 14.55sec 70527 68596 1888 3905 4676 43.2% 3.9% 0.0% 0.0% 147 9739 20153 44.8% 0.0% 96.6%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.19 31.19 146.90 146.90 1.0281 2.9736 2199811
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 52.87% 1887.69 1780 2270 31128
crit 13.5 43.20% 3905.08 3667 4676 52616
dodge 1.2 3.93% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 81.1 55.20% 9739.38 9160 12026 789746
crit 65.8 44.80% 20153.03 18870 24774 1326321

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 78 0.3% 1.0 0.00sec 35264 34963 23024 47417 47499 53.8% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0086 0.0000 35264
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 42.34% 23023.73 20050 23058 9748
crit 0.5 53.81% 47417.37 41304 47499 25515
dodge 0.0 3.85% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6643 26.1% 15.9 24.85sec 189528 184546 0 0 0 0.0% 3.9% 0.0% 0.0% 213 9517 19693 45.3% 0.0% 94.1%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.85 15.85 212.75 212.75 1.0270 2.0000 3004549
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 96.06% 0.00 0 0 0
dodge 0.6 3.94% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 116.5 54.75% 9517.03 8726 11539 1108506
crit 96.3 45.25% 19693.32 17976 23771 1896043

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.97 13.97 0.00 0.00 1.0262 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6439 25.3% 129.2 3.45sec 22544 22026 15862 32803 39230 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
129.20 129.20 0.00 0.00 1.0235 0.0000 2912600
Direct Results Count Pct Average Min Max Total Damage
hit 68.5 53.02% 15861.87 14983 19043 1086534
crit 55.7 43.09% 32803.32 30865 39230 1826066
dodge 5.0 3.89% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.6 27.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.56 16.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.6 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372_hitcap
feral_charge_cat energy 0.2% 0.0 10
ferocious_bite energy 6.9% 859.1 42
mangle_cat energy 9.8% 466.6 32
rake energy 13.9% 2387.4 30
rip energy 6.3% 7136.1 27
savage_roar energy 5.1% 0.0 24
shred energy 57.9% 757.8 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 31.5 191.5 6.1 0.0%
energy_regen energy 1809.6 4986.0 2.8 0.0%
omen_of_clarity none 30.5 1172.0 38.4 0.0%
tigers_fury energy 16.6 993.8 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.4sec 195.4sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.2 138.4 11.4sec 2.5sec 79% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.7sec 55.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 30.5 0.4 14.5sec 14.3sec 3% 5%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.0sec 81.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.7sec 23.7sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 80.5sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:37.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.6 0.0 27.9sec 27.9sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.4 7.7sec
fury_swipes 54.3 8.3sec
primal_fury 78.5 5.7sec

Statistics & Data Analysis

DPS
Population
Convergence 69.78%
σ of the average dps 5.0399
2 * σ / μ 0.0396%
95% Confidence Intervall ( μ ± 2σ ) ( 25472.29 - 25492.45 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25467.25 - 25497.49 )
Sample Data
σ 503.9865
Minimum 23713.25
Maximum 27950.72
Spread ( max - min ) 4237.47
Range ( max - min ) / 2 2118.74
Range% 8.31
10th Percentile 24862.61
90th Percentile 26144.72
( 90th Percentile - 10th Percentile ) 1282.11
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1564
0.1 scale factor error with delta=300 2257
0.05 scale factor error with delta=300 9031
0.01 scale factor error with delta=300 225779
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBM9JRSSISFSSSPSKSSSSSSB9KISSSSSMLSKSSILB9SPKSSSIKKMB9SSSSSKSISMKS9BSSSSKISSMK9BQSSISKSNSSSB9KSISSSPKSSI9BKMSFSSSSSSSKSISSSBB9SSKSMSSSSIKSB9SSSSKSSISMKB9QSSSKILSSMLKB9SSSSISKSSSSSSB9KISSMLSKSLSI9BKSSSMSSKSIB9SSKSSFLSSSSHSLKSHS9BMSSKHSSSNKB9SHSSKSHSSSKH9BLSHSMSKSSNS9ABJISSSKHHSS9BKHSSSM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7018 5427 5336
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 9.38% 9.38% 961
Spell Crit 16.02% 11.00% 1408
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 23967 829 190
Melee Hit 8.00% 8.00% 961
Melee Crit 46.93% 33.03% 1408
Melee Haste 3.97% 3.97% 508
Expertise 10.42 10.42 313
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.56% 24.22% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 20.18% 20.18% 2184

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372_hitcap
origin="http://chardev.org/?profile=35430"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5336
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=313
# gear_hit_rating=961
# gear_crit_rating=1408
# gear_haste_rating=508
# gear_mastery_rating=2184
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Hunter_BM_T11_372 : 28000dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27999.6 8.28 / 0.03% 2638.9 10.6 10.5 focus 0.00% 60.8
Origin http://chardev.org/?profile=34113
Talents http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
Glyphs
  • bestial_wrath
  • kill_command
  • arcane_shot
  • kill_shot

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31831|26110|16084|10219|7177|4310|2897&chds=0,63662&chco=C79C6E,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E&chm=t++31831++kill_command,C79C6E,0,0,15|t++26110++kill_shot,C79C6E,1,0,15|t++16084++arcane_shot,69CCF0,2,0,15|t++10219++cobra_shot,336600,3,0,15|t++7177++claw,C79C6E,4,0,15|t++4310++ranged,C79C6E,5,0,15|t++2897++melee,C79C6E,6,0,15&chtt=Hunter_BM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:19,18,17,15,13,10,4,3&chds=0,100&chco=69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=arcane_shot|cobra_shot|kill_command|ranged|claw|melee|serpent_sting|kill_shot&chtt=Hunter_BM_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x732zwwqmlpx1sqz233uqx223vrx123wqv023xrv023yrv024zsv024zsswz22yusw122zurrnjhcXWVYgggntx1zuux021xuux120xtuz110vswz12yutwz22yvtw121zusx012yttxz20vsokieZXXclswusuz112vswz120ttwz21xuux110xtvz110vswz12zttwz21yutw011ztrrokidYXWXddfmrvzzvvwz21zwuvz100vtxz01yuvxz20wvvx11zxvvz00zvuxz01yuvxz10wtpljfbZYbiptusuy001xuwy020wvwy11zxvwz000xvxz01zwwyz11yxwy220zyz2200yyzyvtpmkhefgjptvyxwyzz1zxyyy10zyxxz000yxzz010yyzz10zzyy00z0zyz0z0zyzzz10yxurqolkiinqsvvwzzz0zyzzz10&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=92&chtt=Hunter_BM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:62375543353302121zvvuuvupqqrqpmmnppommnooommnppommmmnnmllllmllmmmonnooppponnnnopommmmmlkkjjkkkjjkkllkkkkkkkjjjjkkkkkkkkkkkkkkkkkkkklllmmmnooonnnnnonmmnnnnlkkkkkjiijjkkkkkkkllkkkkkllkkkkklkkkkkkkjjjjjjjjjkllmmmnnnoonmmnnnnnmmlllkkjjiijjjjkkkkkkllllllllllllllllllkkkkkkkkjjjkkllmmnnooooooooonnnoonmlllkkkjjjjjkkkkkkkkkkkkkkkkkllllllllmmnnnnnoopppqrrsssttuuutssssssrrrqqpoonnmmmmmmmmmmmmmmmllllmmmmmmmmmmmmmmmnnnnnnooppqrrstuuvvvvvvvvvvvvutssrqqqoopoopooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28000|max=42368&chxp=1,1,66,100&chtt=Hunter_BM_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,3,3,5,9,11,25,35,59,68,99,125,172,215,255,277,344,381,466,507,532,562,564,556,578,532,529,502,469,381,374,257,236,197,165,108,111,71,62,40,38,23,14,10,12,5,4,2,1,4&chds=0,578&chbh=5&chxt=x&chxl=0:|min=26600|avg=28000|max=29596&chxp=0,1,47,100&chtt=Hunter_BM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_BM_T11_372 28000
arcane_shot 5243 18.7% 146.2 3.08sec 16217 16084 11694 24241 31559 36.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.18 145.90 0.00 0.00 1.0083 0.0000 2370636
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 63.70% 11693.67 10837 15320 1086866
crit 53.0 36.30% 24240.79 22323 31559 1283771

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 70.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:70.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped unless killed.
cobra_shot 4915 17.6% 178.6 2.47sec 12446 10219 9032 18654 23032 35.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.59 178.25 0.00 0.00 1.2179 0.0000 2222643
Direct Results Count Pct Average Min Max Total Damage
hit 114.6 64.27% 9031.57 8766 11181 1034721
crit 63.7 35.73% 18653.87 18059 23032 1187922

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
fervor 0 0.0% 1.7 156.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fervor

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.70 1.70 0.00 0.00 1.0053 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.7 100.00% 0.00 0 0 0

Action details: fervor

Static Values
  • id:82726
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly restores $s1 Focus to you and your pet.
focus_fire 0 0.0% 25.7 17.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.65 25.65 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 25.7 100.00% 0.00 0 0 0

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy Effect stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy Effect stack consumed. Lasts for $d.
kill_command 4817 17.2% 68.0 6.68sec 32012 31831 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 68.0 100.00% 0.00 0 0 0

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:37.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Give the command to kill, causing your pet to instantly inflict $ damage to its target. Your Pet's happiness increases the damage done. The pet must be in combat and within 5 yards of the target to Kill Command.
kill_shot 952 3.4% 16.4 5.42sec 26268 26110 19060 39370 50516 36.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.40 16.26 0.00 0.00 1.0060 0.0000 430683
Direct Results Count Pct Average Min Max Total Damage
hit 10.3 63.40% 19060.17 17624 24522 196455
crit 5.9 36.60% 39369.96 36305 50516 234228

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 4304 15.4% 237.8 1.91sec 8184 4310 5905 12227 16284 36.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
237.76 237.76 0.00 0.00 1.8990 0.0000 1945958
Direct Results Count Pct Average Min Max Total Damage
hit 152.0 63.94% 5904.96 5607 7905 897724
crit 85.7 36.06% 12226.79 11551 16284 1048234

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1182 4.2% 1.0 0.00sec 534545 515482 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2909 4505 41.0% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.01 150.01 1.0370 3.0000 534545
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 88.5 58.98% 2908.58 2793 3927 257353
crit 61.5 41.02% 4505.27 4315 6067 277193

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - cat 11404
call_of_the_wild 0 0.0% 2.7 210.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.67 2.67 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:210.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 3691 32.4% 151.3 3.00sec 11032 7177 6634 13527 21379 63.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 1668955
Direct Results Count Pct Average Min Max Total Damage
hit 54.8 36.20% 6634.07 2885 10689 363316
crit 96.5 63.80% 13526.59 5770 21379 1305639

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
kill_command 4817 42.2% 68.0 6.68sec 32012 0 19718 39682 65182 61.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 0.0000 0.0000 2178035
Direct Results Count Pct Average Min Max Total Damage
hit 26.1 38.42% 19718.49 17460 32591 515457
crit 41.9 61.58% 39681.55 34919 65182 1662578

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.19
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:926.00
  • base_dd_max:926.00
melee 2896 25.4% 418.3 1.08sec 3130 2897 2137 4309 6505 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.29 418.29 0.00 0.00 1.0806 0.0000 1309219
Direct Results Count Pct Average Min Max Total Damage
hit 102.6 24.53% 2136.79 1910 3252 219273
crit 215.5 51.51% 4309.20 3819 6505 928472
glance 100.2 23.96% 1611.39 1432 2439 161474

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.3 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_BM_T11_372
arcane_shot focus 54.8% 901.2 18
kill_command focus 44.9% 1010.8 32
serpent_sting focus 0.3% 42763.6 12
pet - cat
claw focus 100.0% 335.8 33
Resource Gains Type Count focus Average Overflow
cobra_shot focus 178.6 1605.6 9.0 0.1%
fervor focus 1.7 84.8 50.0 0.0%
focus_regen focus 1809.6 2499.6 1.4 0.3%
invigoration focus 96.5 574.4 6.0 0.8%
pet - cat focus
fervor focus 1.7 35.3 20.8 58.4%
focus_fire focus 25.7 85.5 3.3 16.6%
focus_regen focus 1809.6 4075.6 2.3 14.0%
go_for_the_throat focus 85.7 724.0 8.4 15.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 6.9 0.0 70.6sec 70.6sec 15% 12%

Database details

  • id:34471
  • cooldown name:buff_beast_within
  • tooltip:Enraged.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_ap 4.3 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cobra_strikes 18.0 3.9 24.4sec 19.8sec 19% 26%

Database details

  • id:53257
  • cooldown name:buff_cobra_strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
culling_the_herd 6.6 89.9 68.8sec 4.7sec 94% 94%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.4sec 57.4sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
focus_fire 25.7 0.0 17.5sec 17.5sec 84% 84%

Database details

  • id:82692
  • cooldown name:buff_focus_fire
  • tooltip:Ranged haste increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
killing_streak 15.9 0.0 27.8sec 27.8sec 23% 22%

Database details

  • id:
  • cooldown name:buff_killing_streak
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.4sec 55.4sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bestial_wrath 6.9 0.0 70.6sec 70.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_bestial_wrath
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 6.6 89.9 68.8sec 4.7sec 94% 93%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-frenzy 26.6 124.7 17.4sec 3.0sec 89% 92%

Database details

  • id:
  • cooldown name:buff_frenzy
  • tooltip:(null)
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 14.3 0.0 32.9sec 32.9sec 62% 62%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 14.3 381.8 32.9sec 1.1sec 98% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.9 6.1 9.6sec 8.4sec 18% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.39%
σ of the average dps 4.1400
2 * σ / μ 0.0296%
95% Confidence Intervall ( μ ± 2σ ) ( 27991.28 - 28007.84 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27987.14 - 28011.98 )
Sample Data
σ 413.9950
Minimum 26599.60
Maximum 29595.91
Spread ( max - min ) 2996.31
Range ( max - min ) / 2 1498.16
Range% 5.35
10th Percentile 27478.94
90th Percentile 28542.05
( 90th Percentile - 10th Percentile ) 1063.11
Approx. Iterations needed for
1% dps error 8
0.1% dps error 874
0.1 scale factor error with delta=300 1523
0.05 scale factor error with delta=300 6093
0.01 scale factor error with delta=300 152348
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B bestial_wrath,if=focus>60
C multi_shot,if=target.adds>5
D cobra_shot,if=target.adds>5
E serpent_sting,if=!ticking
F kill_shot
G rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
H kill_command
I fervor,if=focus<=20
J focus_fire,five_stacks=1,if=!buff.beast_within.up
K arcane_shot,if=focus>=90|buff.beast_within.up
L cobra_shot

Sample Sequence

0134579BEHKKKKKHKKLLJKHLKLKLHLLKLKHLJLKLKHLLKLKHLKGLKJLHLLKKLHLKLKKLHJLLKLKHLLKLKBHKKKKKHKKKJLLHLLLLKHLLLKLHJLLKLKHLLLKLHLJKLKLHLL9KLKHLLJKLKHLLLKKHLLBKKKHKKKKKHJLLLLHLLKLKHLLJKLKHLLLKLHLLKKJLHLKLLKHLLLKKHJLLLKLHLLKLKHLBKKKKHKKKKKJLHILLKLHLLKLKHJL9LKLKHLLLKKHLLJLKLHLLKKLHLKLJKLHLLKKLHLKLBKKHKKKKKHKJLLLLHLKLKKHLLJLKLHLLKKLHLLKJLKHLLKLKHLLLKLHJLGKKLKHLLKLKHLBKKKKHKKK9KKJLHILLKKHLLLKLHJLKLKLHLKLKLHLJKLKLHLLKLKHLLKJLKHLLLKLHLKLBKKHKKKKKHKJLLFFHLLKLKHLFFJKLHLKLKLFFHLKLJKLHLFFKLHLLKLKF9FHJL4LKLKHLLFBFKHKKKKKHKFFJLLHLLKLKFFHLLJKLKHLFFLKHLLKLJKFFHLKLK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 8466 5817 5345
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 26125 14968 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.39% 29.23% 2305
Melee Haste 13.46% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.11% 6.87% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 2
One with Nature 3
Bestial Discipline 3
Pathfinding 0
Spirit Bond 2
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 3
Fervor 1
Focus Fire 1
Longevity 3
Killing Streak 2
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 1
Ferocious Inspiration 1
Kindred Spirits 2
The Beast Within 1
Invigoration 2
Beast Mastery 1
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 0
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_BM_T11_372
origin="http://chardev.org/?profile=34113"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
glyphs=bestial_wrath/kill_command/arcane_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/bestial_wrath,if=focus>60
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking
actions+=/kill_shot
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/fervor,if=focus<=20
actions+=/focus_fire,five_stacks=1,if=!buff.beast_within.up
actions+=/arcane_shot,if=focus>=90|buff.beast_within.up
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010122000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372 : 31630dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31630.3 15.95 / 0.05% 2788.0 11.3 11.2 focus 0.00% 59.9
Origin http://chardev.org/?profile=34117
Talents http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
Glyphs
  • steady_shot
  • aimed_shot
  • rapid_fire

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:35844|22349|20354|7406|4497|3321|1582&chds=0,71688&chco=336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++35844++chimera_shot,336600,0,0,15|t++22349++aimed_shot,C79C6E,1,0,15|t++20354++kill_shot,C79C6E,2,0,15|t++7406++steady_shot,C79C6E,3,0,15|t++4497++ranged,C79C6E,4,0,15|t++3321++claw,C79C6E,5,0,15|t++1582++melee,C79C6E,6,0,15&chtt=Hunter_MM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,18,13,9,8,7,7,5,5,3,1&chds=0,100&chco=C79C6E,C55D54,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=aimed_shot|piercing_shots|steady_shot|chimera_shot|ranged|aimed_shot_mm|wild_quiver_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7pYjxighjfsurillehiiffggacfjfcfhddghfefhgfklhkljlljllkkihdcdcbaabcbbbccbaaabaaaaabaaabbbabbbbccddeeeeeedddeeeeeeeeeeeeeeeeeeeddeeeeeededddddddedddddddddddddddddddeeeeeeeeeeeeeeeeeeeefffgfgffeeeeeeedddddddddddddddddddeddddZVYdhjkkjigbXXadgijjjheaZbehijhghhfcaaabdfhigdbaabcdghhfcbbbcdfhihfcbbbceghihfcbbcdegiihecbccdfhiigecccdegijjgedcdefhjjigedddeghjjhfedddeghjjhgfeefgikkjhfeddefhijhfeeeefgijjhgffefghjkjigfffghikkjhdZaejoqpmkifcbeimoonlifcbfjnonljhf&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:00z004244434675443110zyzyxvvttsrssrrrrrssssssssssssssssrrqqpponnmlkkjiihhggfffeeeeddddcccccbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbbaaaaaaZZZZZYYYYYYYYYYYZaaaabbccdefgghhhiijjkkllllllllkjjjiiihggfeddccbbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZZZZZZaaaaaaaaaaaabbbbbbccccddeeeeffffffggghhhhhhggffgggghghg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31630|max=62318&chxp=1,1,51,100&chtt=Hunter_MM_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,4,4,3,10,13,31,63,82,95,120,149,193,278,362,442,490,501,615,609,642,621,639,611,515,522,432,370,340,284,257,169,153,105,89,64,47,19,16,18,9,2,3,4,2,1,0,1&chds=0,642&chbh=5&chxt=x&chxl=0:|min=28641|avg=31630|max=35008&chxp=0,1,47,100&chtt=Hunter_MM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372 31630
aimed_shot 7625 24.1% 77.1 5.87sec 44703 22349 27700 59063 70452 54.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.13 76.97 0.00 0.00 2.0002 0.0000 3448167
Direct Results Count Pct Average Min Max Total Damage
hit 35.0 45.49% 27700.05 26825 34200 969884
crit 42.0 54.51% 59062.56 55260 70452 2478283

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2160 6.8% 23.4 18.82sec 41742 0 28033 58365 71552 45.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.40 23.36 0.00 0.00 0.0000 0.0000 976884
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 54.54% 28032.93 27244 34734 357109
crit 10.6 45.46% 58364.75 56123 71552 619775

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
chimera_shot 2881 9.1% 35.9 10.59sec 36296 35844 26237 54136 61279 36.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.90 35.80 0.00 0.00 1.0126 0.0000 1302909
Direct Results Count Pct Average Min Max Total Damage
hit 22.8 63.59% 26237.04 25522 29747 597208
crit 13.0 36.41% 54136.07 52576 61279 705702

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 398 1.3% 8.7 10.62sec 20582 20354 15055 31014 34397 36.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.75 8.64 0.00 0.00 1.0112 0.0000 180059
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.81% 15055.10 14794 16697 83047
crit 3.1 36.19% 31014.24 30476 34397 97013

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 5732 18.1% 160.7 2.80sec 16126 0 0 0 0 0.0% 0.0% 0.0% 0.0% 363 7143 0 0.0% 0.0% 80.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.74 160.74 362.90 362.90 0.0000 1.0000 2592100
Direct Results Count Pct Average Min Max Total Damage
hit 160.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 362.9 100.00% 7142.70 816 35160 2592100

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3762.45
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 2596 8.2% 146.8 3.09sec 7998 4497 5732 11863 13905 37.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.77 146.77 0.00 0.00 1.7784 0.0000 1173911
Direct Results Count Pct Average Min Max Total Damage
hit 92.5 63.04% 5731.89 5550 6750 530343
crit 54.2 36.96% 11863.38 11432 13905 643568

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 818 2.6% 1.4 101.42sec 260423 258054 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2418 3742 40.6% 0.0% 83.0%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.42 1.42 125.08 125.08 1.0092 3.0000 369801
Direct Results Count Pct Average Min Max Total Damage
hit 1.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 74.2 59.35% 2418.32 2353 2717 179533
crit 50.8 40.65% 3742.24 3635 4198 190268

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4069 12.9% 208.1 2.16sec 8841 7406 5919 12353 14446 45.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.13 207.75 0.00 0.00 1.1937 0.0000 1840119
Direct Results Count Pct Average Min Max Total Damage
hit 112.9 54.33% 5918.92 5786 7013 668089
crit 94.9 45.67% 12352.82 11919 14446 1172030

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2063 6.5% 121.9 3.69sec 7658 0 5586 11217 13159 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.86 121.86 0.00 0.00 0.0000 0.0000 933182
Direct Results Count Pct Average Min Max Total Damage
hit 77.0 63.20% 5585.57 5420 6580 430140
crit 44.8 36.80% 11216.77 10840 13159 503042

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3290
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1708 51.9% 151.3 3.00sec 5105 3321 3352 6772 10441 51.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 772265
Direct Results Count Pct Average Min Max Total Damage
hit 73.8 48.76% 3352.37 1767 5220 247275
crit 77.5 51.24% 6771.70 3535 10441 524990

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1582 48.1% 384.5 1.17sec 1860 1582 1275 2565 3174 51.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
384.51 384.51 0.00 0.00 1.1754 0.0000 715002
Direct Results Count Pct Average Min Max Total Damage
hit 95.5 24.83% 1274.78 1181 1587 121715
crit 196.7 51.16% 2565.41 2361 3174 504666
glance 92.3 24.01% 960.00 885 1190 88621

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372
aimed_shot focus 68.5% 980.8 46
chimera_shot focus 30.8% 824.9 44
serpent_sting focus 0.7% 10416.9 25
pet - cat
claw focus 100.0% 184.3 28
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.6 2353.4 1.3 2.7%
glyph_aimed_shot focus 52.7 260.5 4.9 1.1%
rapid_recuperation focus 312.4 339.3 1.1 6.0%
steady_shot focus 208.1 2132.8 10.2 0.2%
pet - cat focus
focus_regen focus 1809.6 3663.2 2.0 13.5%
go_for_the_throat focus 54.2 469.0 8.6 13.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.8 67.7 46.8sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.8sec 55.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.1 68.5 42.9sec 5.7sec 95% 95%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.2 94.9 18.8sec 3.8sec 71% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.5 0.0 18.8sec 18.8sec 5% 5%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.4sec 86.4sec 17% 18%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.6sec 222.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 57.6sec 57.6sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.8 67.7 46.8sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 237.3 45.0sec 1.8sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.1 6.5 9.7sec 8.5sec 16% 30%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 121.9 3.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.59%
σ of the average dps 7.9746
2 * σ / μ 0.0504%
95% Confidence Intervall ( μ ± 2σ ) ( 31614.38 - 31646.27 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31606.40 - 31654.25 )
Sample Data
σ 797.4595
Minimum 28640.84
Maximum 35008.30
Spread ( max - min ) 6367.45
Range ( max - min ) / 2 3183.73
Range% 10.07
10th Percentile 30659.95
90th Percentile 32694.30
( 90th Percentile - 10th Percentile ) 2034.34
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2542
0.1 scale factor error with delta=300 5652
0.05 scale factor error with delta=300 22611
0.01 scale factor error with delta=300 565281
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
M steady_shot

Sample Sequence

0134568AGHL6L6MIL6ML6ML6MIL6L6ML6MIML6KL6L6MIML6MML6MML6MMMGL6LL6L6MIL6ML6MIL6ML6MIL6MMML6MML6KL6MIL6ML6MIML6MML6MEMIMFKMML6MMMFMMML6KMIFL6MMMML6FMMLMMML6FMIMLML6MFMIL6MMMMFLML6MIMMMFL6MIMMMAKFL6MIL6MMMMFMML6KL6MIFML6MIMMMFKL6MGH5IFMML6ML6KL6L6MFMGIML6ML6MIL6FKL6MIL6MMML6FMIML6KMIFL6MMMMML6FKL6MIML6MFMIML6MMMFMMLL6MMMFMML6MMMMFKML6MIMML6MFMIML6MMMFKML6MIMMFMML6MAMMKFMML6MMMMLFML6MIMML6FMMMLMML6FMMML6KMIFL6MML6MGHFKMIL6L6MML6MFML6GMIL6JL6MFLMIL6L6JMMFML6MIJML6FMIML6JMIFKML6MIJMFL6MIMMJL6FMML6MMJKMFMIL6MJMIFLL6MIJML6FMIL6KJMIFL6MMMJL6AMF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8471 5822 5345
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.43% 12.43% 2229
Spell Haste 16.28% 10.75% 1376
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20914 11984 190
Melee Hit 8.04% 8.04% 966
Melee Crit 41.98% 28.82% 2229
Melee Haste 14.07% 10.75% 1376
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.12% 6.89% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 2
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 2
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372
origin="http://chardev.org/?profile=34117"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
glyphs=steady_shot/aimed_shot/rapid_fire
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2229
# gear_haste_rating=1376
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372_Arcane : 31036dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31035.5 13.51 / 0.04% 2911.3 10.7 10.5 focus 0.00% 59.1
Origin http://chardev.org/?profile=34115
Talents http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
Glyphs
  • steady_shot
  • rapid_fire
  • arcane_shot

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:36121|24671|20483|13051|7376|4313|3607|1689&chds=0,72242&chco=336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++36121++chimera_shot,336600,0,0,15|t++24671++aimed_shot,C79C6E,1,0,15|t++20483++kill_shot,C79C6E,2,0,15|t++13051++arcane_shot,69CCF0,3,0,15|t++7376++steady_shot,C79C6E,4,0,15|t++4313++ranged,C79C6E,5,0,15|t++3607++claw,C79C6E,6,0,15|t++1689++melee,C79C6E,7,0,15&chtt=Hunter_MM_T11_372_Arcane+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:15,14,14,11,9,8,7,6,6,5,3,1&chds=0,100&chco=C55D54,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,C79C6E&chl=piercing_shots|steady_shot|aimed_shot|ranged|chimera_shot|wild_quiver_shot|aimed_shot_mm|arcane_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372_Arcane+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7nSdranVjYfsjogeggffecfcZageYaegcbbdfcabhhgjlhiihhjjhjicccccaYXYZYXWWXYXWVVWWWVUUVVUUUUUUUUUUUUUUUVUUUVUUTTUUUUUUUUUTTUUUUUUUUTTTUUUUUUUUTTUUUUUUUUTTTUUUUUUUUTUUUVVVVVVVVVVVVVVVVUVZccaWVWWXXURSUVUTRQQRSTVWWVTSRRSTVWXWUSRUUSUbhihjihheYWXaeiiiihfcZZbehhdabbYUQOOPSWZbaWSPNOQUYbbZUQONPSWacbXSPNOQUYbcZVROOPSWZcbXTQOOQUYbcaWSPPQTXbdcZURPPRUYbdbXTQPQSWaccZVRPPRUYbcddaZYWWZccZVUUUSQPQSVXYYXUSRSTWYZZYWUTSTVXZaaYWUTTUWYaaaaXWYcinpnkigcZZbfilmlkhebacfikliebZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372_Arcane+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz1y2033444577544321110z0xyvutsrsrrrrrrrrrrrrrrrrrrrrrrqqqpponnmllkjjiihhggffffeeeeddddccccbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZYYYYYYYYYYZaaaabbbcddegghhhiijjjkllmllllllkjjjiiihgffeddcccbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZYYZZZZZZZZZZZZaaaaaaaaaaaaaaaaZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaabbbbbccdddeeeeeeffggggggggggffgggghhhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31036|max=61412&chxp=1,1,51,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,0,1,4,2,12,12,25,35,57,82,106,136,204,260,296,328,407,502,500,598,590,608,632,604,582,549,481,461,378,339,286,225,195,131,81,89,56,58,30,16,18,5,8,1,4,1,2,1&chds=0,632&chbh=5&chxt=x&chxl=0:|min=28477|avg=31036|max=33749&chxp=0,1,49,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372_Arcane 31036
aimed_shot 4190 13.5% 37.0 11.51sec 51157 24671 28313 60352 70327 71.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.04 36.99 0.00 0.00 2.0736 0.0000 1895075
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 28.47% 28313.05 26771 34139 298119
crit 26.5 71.53% 60351.97 55149 70327 1596955

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2193 7.1% 23.6 18.70sec 41975 0 27990 58319 71426 46.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.62 23.58 0.00 0.00 0.0000 0.0000 991619
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 53.65% 27989.83 27189 34673 354147
crit 10.9 46.35% 58319.37 56010 71426 637472

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
arcane_shot 1986 6.4% 68.5 5.41sec 13117 13051 9470 19501 21283 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.47 68.29 0.00 0.00 1.0051 0.0000 898105
Direct Results Count Pct Average Min Max Total Damage
hit 43.2 63.30% 9469.83 9291 10332 409329
crit 25.1 36.70% 19501.46 19140 21283 488777

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
chimera_shot 2892 9.3% 36.0 10.55sec 36345 36121 26185 54031 61176 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.99 35.89 0.00 0.00 1.0062 0.0000 1307885
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.17% 26185.15 25473 29697 593725
crit 13.2 36.83% 54031.01 52474 61176 714160

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 405 1.3% 8.9 10.49sec 20631 20483 15035 30967 34332 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.87 8.76 0.00 0.00 1.0072 0.0000 182955
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.24% 15034.56 14766 16666 83270
crit 3.2 36.76% 30966.60 30419 34332 99685

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 4772 15.4% 150.1 3.00sec 14381 0 0 0 0 0.0% 0.0% 0.0% 0.0% 358 6028 0 0.0% 0.0% 79.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.06 150.06 358.02 358.02 0.0000 1.0000 2157976
Direct Results Count Pct Average Min Max Total Damage
hit 150.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 358.0 100.00% 6027.52 815 33336 2157976

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:857.03
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 3548 11.4% 201.5 2.25sec 7962 4313 5704 11791 13885 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
201.51 201.51 0.00 0.00 1.8460 0.0000 1604401
Direct Results Count Pct Average Min Max Total Damage
hit 126.8 62.92% 5704.44 5541 6740 723226
crit 74.7 37.08% 11791.43 11414 13885 881175

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 817 2.6% 1.7 124.03sec 213060 211572 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2414 3735 41.1% 0.0% 82.9%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.73 1.73 124.91 124.91 1.0070 3.0000 369360
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.6 58.91% 2414.10 2349 2713 177648
crit 51.3 41.09% 3735.23 3629 4191 191712

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4194 13.5% 213.2 2.11sec 8894 7376 5913 12342 14426 46.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
213.25 212.85 0.00 0.00 1.2057 0.0000 1896593
Direct Results Count Pct Average Min Max Total Damage
hit 113.6 53.38% 5912.59 5777 7003 671752
crit 99.2 46.62% 12342.20 11901 14426 1224841

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2497 8.0% 147.6 3.05sec 7650 0 5570 11178 13141 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.64 147.64 0.00 0.00 0.0000 0.0000 1129455
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 62.92% 5570.01 5412 6570 517403
crit 54.8 37.08% 11178.32 10823 13141 612052

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3544
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1855 52.4% 151.3 3.00sec 5545 3607 3644 7337 10421 51.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 838837
Direct Results Count Pct Average Min Max Total Damage
hit 73.4 48.53% 3644.06 1764 5211 267569
crit 77.9 51.47% 7336.89 3527 10421 571268

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1689 47.6% 410.1 1.10sec 1862 1689 1273 2561 3168 51.6% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
410.09 410.09 0.00 0.00 1.1021 0.0000 763415
Direct Results Count Pct Average Min Max Total Damage
hit 100.2 24.44% 1272.72 1178 1584 127572
crit 211.4 51.56% 2560.98 2356 3168 541516
glance 98.4 24.00% 958.56 884 1188 94327

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372_Arcane
aimed_shot focus 35.0% 1122.7 46
arcane_shot focus 31.2% 596.2 22
chimera_shot focus 32.8% 826.0 44
serpent_sting focus 0.9% 8522.4 25
pet - cat
claw focus 100.0% 201.8 27
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.6 2356.6 1.3 1.2%
rapid_recuperation focus 312.7 345.6 1.1 3.8%
steady_shot focus 213.2 2059.0 9.7 0.0%
pet - cat focus
focus_regen focus 1809.6 3474.6 1.9 16.7%
go_for_the_throat focus 74.7 631.1 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.7 68.2 47.1sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.1sec 55.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.5 68.9 41.2sec 5.6sec 96% 97%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.4 95.8 18.6sec 3.7sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.7 0.0 18.7sec 18.7sec 7% 7%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.1 0.0 80.1sec 80.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 17%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.2sec 222.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.1sec 55.1sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.7 68.2 47.1sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 248.7 45.0sec 1.7sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 55.9 6.6 8.0sec 7.2sec 20% 37%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 147.6 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.49%
σ of the average dps 6.7532
2 * σ / μ 0.0435%
95% Confidence Intervall ( μ ± 2σ ) ( 31022.01 - 31049.03 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31015.26 - 31055.78 )
Sample Data
σ 675.3198
Minimum 28477.25
Maximum 33748.59
Spread ( max - min ) 5271.34
Range ( max - min ) / 2 2635.67
Range% 8.49
10th Percentile 30185.04
90th Percentile 31929.89
( 90th Percentile - 10th Percentile ) 1744.86
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1893
0.1 scale factor error with delta=300 4053
0.05 scale factor error with delta=300 16215
0.01 scale factor error with delta=300 405383
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
M arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
N steady_shot

Sample Sequence

0134568AGHL6L6NIL6NL6NL6NIL6NL6NNLL6NNL6NNNL6NNNL6NNL6KL6NGIL6NNL6NL6NIL6NNL6NNL6NNLL6NNNL6NNNL6NNLL6NNNL6NNNEFKNIMNNNMFNMNINNMNFKMNINNMNFMNIMNNNMFKNIMNNNMFNMNINNMKFNMNINNMNMFNIMKNNMNFMNAINL6NNNFKNMNINNMFMNNMNKNNFMNMNINNMFKGH5NFNIL6NNL6NNLFNL6GNIL6NL6NNFKNL6NIL6NNFMNMNINNKFMNMNINNMFNMNIKNNMFMNNMNNNNFMNMNINNKFMMNINNMNFMNIMNNNKMFNIMMNNNNFMNMNIKNNFMNMNINNMAFKNNL6NNNL6NNFNNMNKNNMFNMNINNKMFNMNINNMNFMNIMKNNMNFGHFNIL6NL6NIL6FKL6NGIL6JNL6NFNIL6NL6JKMMFNIMNJNMNFMMNIJNNMFKMNIJNMNFMNIMNJNMNFKMMNIJNMFNIMMNJNIFKMNMNIJNFMNIMNNJMFNMNIAL6NJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8449 5801 5325
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20860 11942 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.34% 29.18% 2305
Melee Haste 12.35% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.08% 6.84% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.96% 11.96% 710

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 1
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 1
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 2
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372_Arcane
origin="http://chardev.org/?profile=34115"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
glyphs=steady_shot/rapid_fire/arcane_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5325
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=710
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_SV_T11_372 : 26517dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26516.9 7.43 / 0.03% 2621.8 10.1 10.0 focus 0.00% 51.1
Origin http://chardev.org/?profile=34116
Talents http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
Glyphs
  • arcane_shot
  • explosive_shot
  • kill_shot

Charts

http://8.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:34039|31805|28222|17490|11642|3997|3848|1429|901&chds=0,68077&chco=C41F3B,9482C9,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++34039++explosive_shot,C41F3B,0,0,15|t++31805++black_arrow,9482C9,1,0,15|t++28222++kill_shot,C79C6E,2,0,15|t++17490++arcane_shot,69CCF0,3,0,15|t++11642++cobra_shot,336600,4,0,15|t++3997++claw,C79C6E,5,0,15|t++3848++ranged,C79C6E,6,0,15|t++1429++melee,C79C6E,7,0,15|t++901++wolverine_bite,C79C6E,8,0,15&chtt=Hunter_SV_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:28,23,14,7,7,6,5,5,4,1,0&chds=0,100&chco=336600,C41F3B,C79C6E,C79C6E,69CCF0,336600,C79C6E,9482C9,C79C6E,C79C6E,336600&chl=cobra_shot|explosive_shot|ranged|claw|arcane_shot|serpent_sting|melee|black_arrow|kill_shot|wolverine_bite|serpent_sting_burst&chtt=Hunter_SV_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yuXYn04mmz687ut2213upuwwyxiZYZgqnmsvvyyrswuvysuzzyzsjgggilnprsrsstuuttttttsplfbZabdgknqstuvwwwvuuuttrmheccdehjmoqrstuuuuttssspmhecbbdfhkmoqssttuutttsrpmjfdccdfhkmoqstuuuuuuutsqnkigffghjlnpqsttuuuutttrpnkhfedefhjlnoqrsttttttssrpomlmmnpqrstuuuttttuutsrqomkiggghjkmoprsttuuuutsrqomkigfffhikmnpqsstttttsrqonmllllmnprtttuvvvutttssrpnljhggghiklnpqrsstttttsrpnljigggghiklmoqrsssttssqpnljigfffghjkmnoqrssssssrpomlkjjkloqrtuvwwwwvvuutsqpnljihgghhiklmnpqrrssssrq&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Hunter_SV_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:22333464444468765422zyxxwwvtuutstsrrrqrsrrrqpoonnnmmmmmmmnnnmnnnononnmmllllkkkkkkkkkkkkklllllkkkjjjjjjjijiijijjjjjkkkkkkkkkjkjjjjjjjjjjjjjjjkjjjjjiiiiihihiiiiiijjjjkkkkkkkkkkkkjjjjjjjjjkkkkkkkkkjjjjjiiiiiiiiiiiiiiijjjjjjjjjijijjjjjjjjkjkkkllllllllllkkkkkkkkkkkkkkkkkkkkkkkjjjjjjjjijjjjjjjjjkkkklllllmmmmnnoopooppppppppooonnnmmllllllllmmmmmmnnnnnnnnnmmmmmmmmmmmnnnnnnnoonnonnnnmnnmmmmmmmmmmmnnnnnnnnnnnnnnonnoooooppppppppppppppooooooooooooopppppppqpqqqq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26517|max=40894&chxp=1,1,65,100&chtt=Hunter_SV_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,3,6,8,12,26,23,37,64,67,118,152,177,257,310,354,416,489,529,513,572,616,650,585,614,535,453,470,392,308,268,253,191,133,111,76,57,41,32,37,16,9,4,7,2,3,0,1,2&chds=0,650&chbh=5&chxt=x&chxl=0:|min=25197|avg=26517|max=28043&chxp=0,1,46,100&chtt=Hunter_SV_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_SV_T11_372 26517
arcane_shot 1783 6.7% 45.9 9.71sec 17585 17490 12471 25810 29416 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.86 45.79 0.00 0.00 1.0054 0.0000 806392
Direct Results Count Pct Average Min Max Total Damage
hit 28.2 61.48% 12471.15 12080 14280 351098
crit 17.6 38.52% 25810.50 24885 29416 455295

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 1298 4.9% 18.4 25.22sec 31976 31805 0 0 0 0.0% 0.0% 0.0% 0.0% 90 4611 9673 38.0% 0.0% 59.6%

Stats details: black_arrow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.36 18.32 89.79 89.79 1.0054 3.0000 586957
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 55.6 61.96% 4610.96 4458 5425 256530
crit 34.2 38.04% 9673.18 9317 11339 330427

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $o1 Shadow damage over $d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.095000
  • base_td:407.33
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
cobra_shot 7471 28.2% 210.3 2.14sec 16065 11642 10637 22110 25195 47.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.32 209.94 0.00 0.00 1.3800 0.0000 3378731
Direct Results Count Pct Average Min Max Total Damage
hit 110.1 52.43% 10636.50 10408 12231 1170858
crit 99.9 47.57% 22109.91 21440 25195 2207874

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
explosive_shot 6123 23.1% 80.9 5.62sec 34241 34039 0 0 0 0.0% 0.0% 0.0% 0.0% 240 7776 16321 44.2% 0.0% 35.2%

Stats details: explosive_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.87 80.69 239.68 239.68 1.0059 0.6633 2768957
Direct Results Count Pct Average Min Max Total Damage
hit 80.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.7 55.80% 7775.78 7501 9310 1039883
crit 105.9 44.20% 16320.78 15678 19458 1729074

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:Taking $w1 Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing $ Fire damage. The charge will blast the target every second for an additional $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.232000
  • base_td:353.32
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
kill_shot 950 3.6% 15.1 5.87sec 28383 28222 18195 37656 43151 54.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.14 14.95 0.00 0.00 1.0057 0.0000 429612
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 45.87% 18194.70 17321 20947 124790
crit 8.1 54.13% 37655.55 35682 43151 304822

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 3841 14.5% 207.4 2.19sec 8376 3848 5942 12291 14027 38.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.38 207.38 0.00 0.00 2.1765 0.0000 1736927
Direct Results Count Pct Average Min Max Total Damage
hit 127.9 61.67% 5941.56 5765 6809 759822
crit 79.5 38.33% 12290.86 11876 14027 977105

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1678 6.3% 1.0 1.00sec 758858 731710 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3137 6578 53.2% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.01 150.01 1.0371 3.0000 745101
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 70.2 46.81% 3137.02 3047 3676 220282
crit 79.8 53.19% 6577.60 6369 7682 524819

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
serpent_sting_burst 15 0.1% 1.0 1.00sec 6953 0 4834 9959 9959 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 6954
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 58.66% 4834.42 4834 4834 2836
crit 0.4 41.34% 9958.90 9959 9959 4118

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3903.54
  • base_dd_max:3903.54
pet - wind_serpent 3389
claw 1826 53.9% 134.4 3.36sec 6143 3997 4234 8519 12431 44.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.35 134.35 0.00 0.00 1.5370 0.0000 825370
Direct Results Count Pct Average Min Max Total Damage
hit 74.5 55.44% 4233.84 1978 6215 315332
crit 59.9 44.56% 8518.64 3955 12431 510037

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
lightning_breath 0 0.0% 15.5 30.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_breath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.47 15.47 0.00 0.00 1.4622 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.5 100.00% 0.00 0 0 0

Action details: lightning_breath

Static Values
  • id:24844
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases magic damage taken by $s2%.
  • description:Breathes lightning, increasing magic damage taken by $s2% for $d.
melee 1429 42.1% 322.0 1.40sec 2006 1429 1442 2899 3779 44.6% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
322.00 322.00 0.00 0.00 1.4032 0.0000 645782
Direct Results Count Pct Average Min Max Total Damage
hit 101.3 31.45% 1441.76 1321 1889 146015
crit 143.5 44.55% 2899.33 2643 3779 415955
glance 77.3 23.99% 1084.81 991 1417 83811

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
roar_of_recovery 0 0.0% 2.8 181.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_recovery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: roar_of_recovery

Static Values
  • id:53517
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1 focus every $t1 sec.
  • description:Your pet's inspiring roar restores $o1 focus over $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
wolverine_bite 135 4.0% 45.1 10.08sec 1351 901 933 1873 2471 44.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolverine_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.12 45.12 0.00 0.00 1.4992 0.0000 60968
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 55.48% 932.61 851 1236 23345
crit 20.1 44.52% 1873.24 1701 2471 37623

Action details: wolverine_bite

Static Values
  • id:53508
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A fierce attack causing $ damage, that your pet can use after it makes a critical attack. Cannot be dodged, blocked or parried.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1.00
  • base_dd_max:1.00

Resources

Resource Usage Type Res% DPR RPE
Hunter_SV_T11_372
arcane_shot focus 22.1% 799.3 22
black_arrow focus 14.0% 913.6 35
explosive_shot focus 63.4% 955.6 36
serpent_sting focus 0.5% 30354.3 25
pet - wind_serpent
claw focus 100.0% 222.2 28
Resource Gains Type Count focus Average Overflow
cobra_shot focus 210.3 1887.4 9.0 0.3%
focus_regen focus 1809.6 2244.8 1.2 0.6%
roar_of_recovery focus 8.2 81.0 9.9 0.7%
thrill_of_the_hunt focus 21.7 306.0 14.1 2.1%
pet - wind_serpent focus
focus_regen focus 1809.6 3020.6 1.7 15.9%
go_for_the_throat focus 79.5 649.1 8.2 18.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
culling_the_herd 18.3 41.6 24.9sec 7.5sec 82% 81%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.6sec 57.6sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
lock_and_load 7.5 0.0 56.5sec 56.5sec 5% 12%

Database details

  • id:56453
  • cooldown name:buff_lock_and_load
  • tooltip:Your next Arcane Shot or Explosive Shot spells trigger no cooldown and cost no focus.
  • max_stacks:2
  • duration:12.00
  • cooldown:22.00
  • default_chance:12.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.9sec 394.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 58.2sec 58.2sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
wind_serpent-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 6%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-culling_the_herd 18.3 41.6 24.9sec 7.5sec 82% 78%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-owls_focus 40.3 0.0 11.0sec 11.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_owls_focus
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:30.00%
wind_serpent-sic_em 17.2 0.5 25.3sec 24.5sec 7% 13%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-wolverine_bite 46.1 177.3 9.9sec 2.0sec 89% 100%

Database details

  • id:
  • cooldown name:buff_wolverine_bite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sniper_training

Database details

  • id:64420
  • cooldown name:buff_sniper_training
  • tooltip:Damage done by your Steady Shot and Cobra Shot increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:300.00%

Uptimes

%

Procs

Count Interval
lock_and_load 7.5 56.5sec
thrill_of_the_hunt 21.7 19.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.80%
σ of the average dps 3.7156
2 * σ / μ 0.0280%
95% Confidence Intervall ( μ ± 2σ ) ( 26509.48 - 26524.34 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26505.76 - 26528.06 )
Sample Data
σ 371.5614
Minimum 25196.83
Maximum 28043.36
Spread ( max - min ) 2846.53
Range ( max - min ) / 2 1423.26
Range% 5.37
10th Percentile 26059.87
90th Percentile 27013.99
( 90th Percentile - 10th Percentile ) 954.11
Approx. Iterations needed for
1% dps error 7
0.1% dps error 785
0.1 scale factor error with delta=300 1227
0.05 scale factor error with delta=300 4908
0.01 scale factor error with delta=300 122718
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B multi_shot,if=target.adds>2
C cobra_shot,if=target.adds>2
D serpent_sting,if=!ticking
E rapid_fire
F explosive_shot,non_consecutive=1
G black_arrow,if=!ticking
H kill_shot
I arcane_shot,if=focus>=70&buff.lock_and_load.down
J cobra_shot

Sample Sequence

0134579DEFGJJJIFJJIJIFJJIJIFJJIJIFJGJJJFJJIJIFJJJIFJJJIFGJJJFJJJJFJJJIFJJJGFJJJJFJJJIFJJJJFJJIGJFJJJFJFIFJJIJF9JJJIFJGJJJFJJJFJFIFJJIJFJGJJFJJJJFJJJIFJJJIFJGJJJFJJJJFJJIJIFJJJJFGJJJFJJJIFJJJIFJJJIFGJJJFJJJ9JFJJFJFIFJJGJFJJJJFJJIJFJJJIJFJGJJJFJFIFJJIJFJJIJEFJGJJIFJJJJIFJJFJFIFJJJIFGJJJFJJJIFJJJIFJJJIGJJFJJJ9JFJJIJFJJIJFJGJJFJJJJFJJJIFJJJJFGJJJFJJIIJFJJIJFJJIJGFJJJHHFJFJFJFJHHJIFJGJJJFHHJJJFJJJHFHJJGFJJ9JH4FHJJIJFJJHHIFJGJJJFHHJJJFJJJHHFIJJGJFJHHJIFJJJIFHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 9526 6553 5367
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.07% 12.07% 2164
Spell Haste 16.68% 11.13% 1425
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 21332 13445 190
Melee Hit 8.04% 8.04% 966
Melee Crit 44.86% 30.71% 2164
Melee Haste 14.46% 11.13% 1425
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 14.07% 8.30% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.32% 11.32% 596

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 0
Bestial Discipline 1
Pathfinding 0
Spirit Bond 0
Frenzy 0
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 2
Survival Tactics 2
Trap Mastery 3
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 3
Counterattack 0
Lock and Load 2
Resourcefulness 3
Mirrored Blades 0
T.N.T. 2
Toxicology 2
Wyvern Sting 1
Noxious Stings 2
Hunting Party 1
Sniper Training 3
Serpent Spread 1
Black Arrow 1

Profile

#!./simc

hunter=Hunter_SV_T11_372
origin="http://chardev.org/?profile=34116"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
glyphs=arcane_shot/explosive_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking
actions+=/rapid_fire
actions+=/explosive_shot,non_consecutive=1
actions+=/black_arrow,if=!ticking
actions+=/kill_shot
actions+=/arcane_shot,if=focus>=70&buff.lock_and_load.down
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=5367
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2164
# gear_haste_rating=1425
# gear_mastery_rating=596
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=wind_serpent

Mage_Arcane_T11_372 : 28717dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28716.6 16.13 / 0.06% 13.7 2097.1 1890.0 mana 0.00% 198.8
Origin http://chardev.org/?profile=35357
Talents http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
Glyphs
  • evocation
  • arcane_power
  • slow
  • mirror_image
  • arcane_brilliance
  • conjuring
  • arcane_blast
  • arcane_missiles
  • mage_armor

Charts

http://7.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:41490|32290|17145|15224|1484&chds=0,82979&chco=C41F3B,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++41490++flame_orb,C41F3B,0,0,15|t++32290++arcane_blast,69CCF0,1,0,15|t++17145++arcane_barrage,69CCF0,2,0,15|t++15224++arcane_missiles,69CCF0,3,0,15|t++1484++mirror_arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:88,6,3,2,0,0&chds=0,100&chco=69CCF0,69CCF0,C41F3B,69CCF0,69CCF0,C41F3B&chl=arcane_blast|arcane_missiles|flame_orb_tick|mirror_arcane_blast|arcane_barrage|ignite&chtt=Mage_Arcane_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7776431zywvtrqonmlkihfecbZYWUTRQPOOORWcjqvyzzzzyyxxyyzzzzzyyxyyzz000zyyyzzz00zzyyyyzzz0zzyxwxxyyyyyxxxxxyyyyyyxxxyyyzzzz12221zyxwutsrqponnmlkjjihgfeedcbaZYYXWVUTTSRRQQRSVXbfjorvxz001111100000000z00000000zz0000000zzzzz000000zzz0000000zzzz00000z000000000000zzyxwvutrqponmlkjigfedcbaZYXXWVUTTSRRQQQRSUWZdhlosuwyz00111111000000zzzzzzyyyyyyyxxxxxxwwwwwvvvvvuuuuttttssssrrrrrrrrrrrrrsssssssrrqqpponmmlkjiihgffeddcbaaZYYXWVVUTTSRRRRRRSSTUUVWXYZabdefgghhiijjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=126646&chtt=Mage_Arcane_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:567787654332432zxvtsqpnligdbZXVTSQQPOONNMLKKJJKLMNOOOPPPQRQRRRRSSSSSSSRRRRSSRRRRRRRRRRRRRQRRRRRRRRRRRQPQQQQQQQRRRSUWYZbcefhijlmmmnnnnnnlkihgedbaZYXXXWWWWVVVUTTSRQPONMLKKJJIIIIIJJKKLMNOPQRSSTTUUVUUUUTTTSSSRRRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRSSTTUVVWXYZaabcccdeefeeeeddccbbaZZYYXXWVTSSRQPONMLKKJJIIIIIIIJJKLLMNOPQQRRSSSSSSSSSSSSSRRRRRRRRRRRSSSSSSSSSSSTTTTTTTUUUUUUUVVWWXXXYYZZabcdeefggghhhhhgggffedccbaaZYYXXWWVVUUTTSSRRQQQPPPOOOOOOOOOOOOPPPPPPPQQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28717|max=79183&chxp=1,1,36,100&chtt=Mage_Arcane_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,5,2,11,13,33,50,70,89,124,188,206,289,322,366,425,485,539,551,606,628,611,509,535,545,396,364,370,314,248,217,200,143,127,105,92,75,43,26,22,18,14,6,6,2,4,1,1,0,1&chds=0,628&chbh=5&chxt=x&chxl=0:|min=26249|avg=28717|max=32131&chxp=0,1,42,100&chtt=Mage_Arcane_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Arcane_T11_372 28717
arcane_barrage 126 0.4% 2.7 86.79sec 21431 17145 16146 33195 40836 32.6% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.67 2.66 0.00 0.00 1.2500 0.0000 57167
Direct Results Count Pct Average Min Max Total Damage
hit 1.8 65.92% 16145.55 12599 19489 28334
crit 0.9 32.63% 33194.72 25894 40836 28833
miss 0.0 1.45% 0.00 0 0 0

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1915.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.803000
  • base_dd_min:1054.50
  • base_dd_max:1288.83
arcane_blast 25364 88.3% 261.4 1.73sec 43865 32290 33434 68792 136421 30.8% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.37 261.37 0.00 0.00 1.3585 0.0000 11464809
Direct Results Count Pct Average Min Max Total Damage
hit 177.3 67.82% 33434.36 17124 66421 5926852
crit 80.5 30.80% 68791.93 35192 136421 5537957
miss 3.6 1.38% 0.00 0 0 0

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:870.7
  • cooldown:0.00
  • base_execute_time:2.12
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $s1 Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1%, the casting time is reduced by ${$36032m3/-1000}.1 sec and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.057000
  • base_dd_min:1764.41
  • base_dd_max:2050.53
arcane_missiles 1632 5.7% 21.3 17.36sec 34661 15224 0 0 0 0.0% 0.0% 0.0% 0.0% 106 4962 10194 40.0% 1.4% 9.5%

Stats details: arcane_missiles

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.28 21.28 106.07 105.60 2.2767 0.4069 737643
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 62.0 58.67% 4962.36 3849 6118 307460
crit 42.2 39.96% 10194.32 7909 12587 430183
miss 1.4 1.37% 0.00 0 0 0

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches Arcane Missiles at the enemy, causing $7268s1 Arcane damage every $5143t2 sec for $5143d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.246000
  • base_dd_min:358.06
  • base_dd_max:358.06

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches $?[five]?[four][three] waves of Arcane Missiles at the enemy over $d, causing $7268s1 Arcane damage per wave. Each offensive spell you cast has a $79684h% chance to activate Arcane Missiles.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
arcane_power 0 0.0% 4.4 122.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.38 4.38 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.4 100.00% 0.00 0 0 0

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increased damage and mana cost for your spells.
  • description:When activated, you deal $s1% more spell damage but spells cost $s2% more mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
evocation 0 0.0% 3.4 131.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: evocation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.39 3.39 0.00 0.00 4.9021 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.4 100.00% 0.00 0 0 0

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1% of total mana every $t1 sec.
  • description:Gain $s1% of your mana instantly and another ${$m1*3}% of your total mana over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb 843 2.9% 7.7 61.20sec 49303 41490 0 0 0 0.0% 1.3% 0.0% 0.0% 114 0 0 0.0% 0.0% 25.3%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.73 7.73 114.14 0.00 1.1883 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.65% 0.00 0 0 0
miss 0.1 1.35% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_tick 843 2.9% 114.1 3.75sec 3339 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2534 5253 30.9% 1.4% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.14 0.00 0.00 114.14 0.0000 0.0000 381140
Tick Results Count Pct Average Min Max Total Damage
hit 77.4 67.78% 2534.43 1659 4228 196077
crit 35.2 30.86% 5253.25 3411 8686 185063
miss 1.5 1.36% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 107 0.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 50 971 0 0.0% 0.0% 22.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 31.99 49.89 49.89 0.0000 2.0000 48470
Direct Results Count Pct Average Min Max Total Damage
hit 32.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 49.9 100.00% 971.49 443 5001 48470

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1046.66
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
presence_of_mind 0 0.0% 5.5 91.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell.
pet - mirror_image_3 751
mirror_arcane_blast 751 100.0% 78.5 15.32sec 3709 1484 3605 5416 7616 9.8% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.50 78.50 0.00 0.00 2.5000 0.0000 291178
Direct Results Count Pct Average Min Max Total Damage
hit 69.3 88.24% 3604.91 2114 5078 249704
crit 7.7 9.75% 5415.81 3171 7616 41474
miss 1.6 2.01% 0.00 0 0 0

Action details: mirror_arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing ${($m1+$M1)/2} Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1% and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.275000
  • base_dd_min:224.56
  • base_dd_max:260.98

Resources

Resource Usage Type Res% DPR RPE
Mage_Arcane_T11_372
arcane_barrage mana 0.5% 13.3 1607
arcane_blast mana 96.6% 12.5 3502
conjure_mana_gem mana 1.3% 0.0 12608
flame_orb mana 0.6% 62.5 789
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 28776.0 15.9 2.5%
clearcasting none 24.8 18419.4 742.1 0.0%
evocation mana 13.6 236292.0 17429.8 0.2%
flask mana 1.0 4725.0 4725.0 0.0%
food mana 1.0 1417.5 1417.5 0.0%
initial_mana none 1.0 107548.4 107548.4 0.0%
mage_armor mana 1809.6 381246.1 210.7 2.5%
mana_gem mana 4.1 49801.1 12102.3 0.0%
master_of_elements mana 116.6 22105.2 189.6 0.7%
mp5_regen mana 1809.6 76863.0 42.5 2.4%
replenishment mana 1809.6 53091.3 29.3 2.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
arcane_blast 25.7 235.7 16.5sec 1.7sec 84% 98%

Database details

  • id:36032
  • cooldown name:buff_arcane_blast
  • tooltip:Arcane Blast damage increased by $w1%, casting time reduced by ${$m3/-1000}.1 sec and mana cost increased by $w2%.
  • max_stacks:4
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_missiles 22.2 98.6 18.7sec 3.7sec 71% 71%

Database details

  • id:79683
  • cooldown name:buff_arcane_missiles
  • tooltip:Arcane Missiles activated.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:40.00%
arcane_potency 28.6 1.8 16.1sec 15.1sec 19% 20%

Database details

  • id:
  • cooldown name:buff_arcane_potency
  • tooltip:(null)
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 4.4 0.0 122.1sec 122.1sec 14% 29%

Database details

  • id:12042
  • cooldown name:buff_arcane_power
  • tooltip:Increased damage and mana cost for your spells.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 179.8 81.3 2.5sec 1.7sec 81% 81%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 24.9 0.0 18.5sec 18.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
improved_mana_gem 4.1 0.0 127.3sec 127.3sec 13% 13%

Database details

  • id:
  • cooldown name:buff_improved_mana_gem
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.6 0.0 55.3sec 55.3sec 28% 28%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.4 0.0 50.3sec 50.3sec 25% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shard_of_woe 7.7 0.0 63.4sec 63.4sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shard_of_woe
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.4 0.0 114.6sec 114.6sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 120.7sec 120.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 75.8 189.3sec 5.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
focus_magic_feedback

Database details

  • id:
  • cooldown name:buff_focus_magic_feedback
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mage_armor

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
arcane_blast_0 9.8%
arcane_blast_1 9.4%
arcane_blast_2 9.2%
arcane_blast_3 9.0%
arcane_blast_4 62.5%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 4.1 127.3sec
munched_ignite 3.2 89.5sec
rolled_ignite 5.1 64.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.86%
σ of the average dps 8.0649
2 * σ / μ 0.0562%
95% Confidence Intervall ( μ ± 2σ ) ( 28700.48 - 28732.74 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28692.42 - 28740.80 )
Sample Data
σ 806.4883
Minimum 26249.16
Maximum 32130.63
Spread ( max - min ) 5881.48
Range ( max - min ) / 2 2940.74
Range% 10.24
10th Percentile 27747.89
90th Percentile 29834.08
( 90th Percentile - 10th Percentile ) 2086.19
Approx. Iterations needed for
1% dps error 31
0.1% dps error 3154
0.1 scale factor error with delta=300 5781
0.05 scale factor error with delta=300 23126
0.01 scale factor error with delta=300 578154
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 focus_magic
3 arcane_brilliance
4 mage_armor
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
A volcanic_potion,if=!in_combat
B volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
C arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
D mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
E mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
F flame_orb,if=target.time_to_die>=10
G presence_of_mind,arcane_blast
H arcane_blast,if=target.time_to_die<60&mana_pct>4
I arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
J evocation,invulnerable=1
K evocation,if=target.time_to_die>=31
L sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
M arcane_missiles
N arcane_barrage,if=buff.arcane_blast.stack>0
O arcane_barrage,moving=1
P fire_blast,moving=1
Q ice_lance,moving=1
R restart_sequence,name=conserve

Sample Sequence

0124A9CDEGFIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLLLLMRLLLLLM9FMRLLLLLMRLLLLLMRLLLLGLMRLLLLLMRLLLLLMRLLIIBCDI9FIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKEGL9FLLMRLLLLLMRLLLLLMRLLLLLNRLLLLLMRLLLLLMRLLLLFLMRLLLL9CD7IIIIIIIIIIIGIIIIIIIIIIIIIIIIIKFLMRLLL9LLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLGLLLFLMRLLLLLMIIII9CEIIDIIIIIIIIIIIIIIIIIIIIIIIIIIIFIIKMRLLL9LLMGNMRLLLLLMRLLLLLMRLLLLLNHFHHHHHHHHHHHHCHHH9HDHHHHHHHHHHHHHHHHHHHHHHHHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 631 52 20
Agility 648 68 20
Stamina 7658 6035 5972
Intellect 6116 5416 4957
Spirit 291 291 101
Health 143995 121343 0
Mana 113691 103280 0
Spell Power 9145 7613 2207
Spell Hit 15.63% 15.63% 1601
Spell Crit 24.20% 15.12% 514
Spell Haste 20.14% 14.42% 1420
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 673 32 0
Melee Hit 13.33% 13.33% 1601
Melee Crit 14.56% 6.66% 514
Melee Haste 11.09% 11.09% 1420
Expertise 0.00 0.00 0
Armor 12578 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.05% 17.05% 1622

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 3
Invocation 2
Improved Arcane Missiles 2
Improved Blink 0
Arcane Flows 2
Presence of Mind 1
Missile Barrage 2
Prismatic Cloak 3
Improved Polymorph 0
Arcane Tactics 1
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 2
Slow 1
Nether Vortex 2
Focus Magic 1
Improved Mana Gem 2
Arcane Power 1
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 2
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Arcane_T11_372
origin="http://chardev.org/?profile=35357"
level=85
race=gnome
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
glyphs=evocation/arcane_power/slow/mirror_image/arcane_brilliance/conjuring/arcane_blast/arcane_missiles/mage_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/focus_magic
actions+=/arcane_brilliance
actions+=/mage_armor
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
actions+=/arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
actions+=/flame_orb,if=target.time_to_die>=10
actions+=/presence_of_mind,arcane_blast
actions+=/arcane_blast,if=target.time_to_die<60&mana_pct>4
actions+=/arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
actions+=/evocation,invulnerable=1
actions+=/evocation,if=target.time_to_die>=31
actions+=/sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
actions+=/arcane_missiles
actions+=/arcane_barrage,if=buff.arcane_blast.stack>0
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1
actions+=/restart_sequence,name=conserve
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist=soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5972
# gear_intellect=4957
# gear_spirit=101
# gear_spell_power=2207
# gear_hit_rating=1601
# gear_crit_rating=514
# gear_haste_rating=1420
# gear_mastery_rating=1622
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# trinket2=shard_of_woe,heroic=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_Frostfire_T11_372 : 24898dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24898.0 19.75 / 0.08% 27.0 921.0 791.1 mana 0.00% 39.0
Origin http://chardev.org/?profile=88851
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • frostfire
  • pyroblast
  • molten_armor

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56269|43996|39944|14273|9220|947&chds=0,112537&chco=C41F3B,C41F3B,C41F3B,2459FF,C41F3B,2459FF&chm=t++56269++flame_orb,C41F3B,0,0,15|t++43996++living_bomb,C41F3B,1,0,15|t++39944++pyroblast_hs,C41F3B,2,0,15|t++14273++frostfire_bolt,2459FF,3,0,15|t++9220++scorch,C41F3B,4,0,15|t++947++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:47,15,14,9,7,4,2,1,0,0,0,0&chds=0,100&chco=2459FF,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=frostfire_bolt|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777766555543333222211110zzzyyyyxxxxwwvvuuuuuuutttttsrrrrrrrrrqqqpppooooonnnnmmllllllkkkkjjjiiiiiiihhhhggggffffffeeedddehjiiiiihhgggggfffffeeeddddddcccccbbbaaaaaaaZZZYYYYXXXXXXWWWVVUUUTTTTTSSRRRRQQQQQQPPPOOOONNNNNNMMMLLLLKKKKKKJJJIIIIIHHHHHJLMMMLLLLLLKKKJJJJIIIIIHHHHGGGGGFFFFFFFEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEFFFFFFGGGGGHHHHHHIIIIIIIIIJJJJJJJJJJJJJJJJJJJJKKKKKLLLLLLLMMMMMMNNNNNNNNNOOOOOOOOOOPPPPPPPPQQQQQQRRRRSSSSSSTTTTTTTTTTUUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116469&chtt=Mage_Fire_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:knqrttuwxxy12568764431zxwvusqonlkjhgfeeedddccbbaaaaaabbbbbaaaaaaaabbbbaaZZYYYYYYYYYXXWWWWWWWXXYYYYYYYYYZZaaaaaZZZZZZZZZZZYYYYYZZaabbccccccdddeefffffeeeddddddddccbbbaaaaaaZZZZYYYYZZabcccddeeffgggghggffeedccbbaaZYYXXXXXXXXXXXXXXXXXYYYYZZZZZZZZZaabbbbbbccccccccccdddcccccccccccccccccccddddddccccbbbbbbbaaZZZYYYZZZZZZZZaaaaaabbbbbcccccccbbbbbbbbbbaaaaaaaZZZZZZZZaaabbccdeefghiijjkkkkkkkkjjjiihggfeedddcccccbbbbbbbbbbbbbbccccddddeeeeeeffffffffeeeedddddddddc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24898|max=51110&chxp=1,1,49,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,4,5,10,16,23,49,41,67,92,137,169,191,264,300,319,391,450,522,506,552,568,541,556,521,496,496,427,398,322,277,263,200,189,144,110,93,84,44,57,41,17,12,8,9,4,7,3,2,2&chds=0,568&chbh=5&chxt=x&chxl=0:|min=21785|avg=24898|max=28692&chxp=0,1,45,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_Frostfire_T11_372 24898
combustion 1644 6.6% 3.8 129.75sec 195686 170727 8194 16959 22952 31.2% 0.1% 0.0% 0.0% 53 9957 20739 31.6% 0.0% 8.5%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.80 3.80 52.54 52.54 1.1462 0.7274 743706
Direct Results Count Pct Average Min Max Total Damage
hit 2.6 68.67% 8193.51 7082 11170 21384
crit 1.2 31.19% 16959.24 14552 22952 20100
miss 0.0 0.14% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 35.9 68.38% 9957.12 3394 26081 357709
crit 16.6 31.62% 20738.75 6974 53593 344512

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:8077.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.2 46.25sec 3075 0 2618 4047 4434 32.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.21 10.21 0.00 0.00 0.0000 0.0000 31407
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 67.68% 2618.29 2562 2870 18101
crit 3.3 32.19% 4047.25 3959 4434 13306
miss 0.0 0.13% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
flame_orb 1074 4.3% 7.7 61.13sec 63300 56269 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.85 0.00 1.1250 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.17sec 7216 0 5468 11225 14777 30.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55312
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.33% 5467.61 4925 7191 29057
crit 2.3 30.52% 11225.10 10121 14777 26256
miss 0.0 0.15% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 952 3.8% 114.8 3.70sec 3747 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2820 5835 30.9% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.85 0.00 0.00 114.85 0.0000 0.0000 430363
Tick Results Count Pct Average Min Max Total Damage
hit 79.2 69.00% 2820.27 2437 3893 223503
crit 35.5 30.87% 5834.54 5008 7999 206861
miss 0.1 0.13% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
frostfire_bolt 11592 46.6% 209.2 2.15sec 25062 14273 18533 38243 54480 30.6% 0.1% 0.0% 0.0% 194 490 1010 30.6% 0.0% 98.6%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
209.18 208.53 193.94 193.94 1.7559 2.2983 5242466
Direct Results Count Pct Average Min Max Total Damage
hit 144.5 69.30% 18533.03 16101 26513 2678473
crit 63.8 30.57% 38242.62 33086 54480 2438216
miss 0.3 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.7 69.44% 489.63 228 698 65936
crit 59.3 30.56% 1009.59 548 1435 59841

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:405.75
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
ignite 3748 15.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 214 7907 0 0.0% 0.0% 94.8%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 189.10 214.35 214.35 0.0000 2.0000 1694863
Direct Results Count Pct Average Min Max Total Damage
hit 189.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 214.3 100.00% 7907.03 161 56581 1694863

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10156.57
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4075 16.4% 35.9 12.80sec 51388 43996 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6551 13525 30.7% 0.0% 93.4%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.86 35.86 186.29 186.29 1.1680 2.2664 1619464
Direct Results Count Pct Average Min Max Total Damage
hit 35.8 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.1 69.29% 6551.42 5492 10800 845652
crit 57.2 30.71% 13524.51 11286 22191 773811

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 494 2.0% 35.8 12.65sec 6237 0 4724 9747 13716 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.82 35.82 0.00 0.00 0.0000 0.0000 223407
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 69.63% 4723.78 4154 6675 117819
crit 10.8 30.24% 9747.49 8536 13716 105588
miss 0.0 0.12% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2241 9.0% 21.7 20.19sec 46613 39944 21905 45183 64225 40.6% 0.1% 0.0% 0.0% 99 2358 4864 40.6% 0.0% 50.0%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.74 21.66 99.18 99.18 1.1670 2.2815 1013453
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 59.24% 21904.91 19113 31256 281055
crit 8.8 40.63% 45183.31 39274 64225 397559
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 58.9 59.37% 2358.09 1985 3898 138850
crit 40.3 40.63% 4863.55 4079 8010 195989

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.1 4.45sec 11308 9220 8717 17906 23247 28.5% 0.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2265 0.0000 1677
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 71.14% 8716.60 7718 12010 920
crit 0.0 28.52% 17906.43 15859 23247 757
miss 0.0 0.34% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 572
mirror_fire_blast 117 20.5% 34.3 33.52sec 1219 0 1172 1758 2116 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.29 34.29 0.00 0.00 0.0000 0.0000 41793
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.12% 1172.36 1105 1410 35829
crit 3.4 9.89% 1758.27 1658 2116 5965
miss 0.3 0.99% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 455 79.5% 85.7 12.83sec 1894 947 2024 3036 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.73 77.16 0.00 0.00 2.0000 0.0000 162352
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.08% 2024.12 1912 2421 139118
crit 7.7 9.92% 3036.14 2868 3631 23235
miss 0.8 1.00% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_Frostfire_T11_372
flame_orb mana 1.8% 65.9 960
frostfire_bolt mana 73.9% 17.0 1472
living_bomb mana 23.3% 19.0 2710
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29491.5 16.3 0.0%
clearcasting none 25.1 39621.8 1576.9 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 620.7 112739.3 181.6 0.0%
mana_gem mana 3.0 36310.6 12103.5 0.0%
master_of_elements mana 110.1 40242.2 365.6 0.0%
mp5_regen mana 1809.6 78693.7 43.5 0.0%
replenishment mana 1809.6 54437.9 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 210.1 0.0 2.1sec 2.1sec 80% 80%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 21.8 1.0 20.1sec 19.2sec 9% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.2 0.0 52.0sec 52.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 34% 34%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 507.6sec 507.6sec 66% 66%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.4sec 47.4sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.1sec 115.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.6sec 414.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.9 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.9sec
munched_ignite 121.5 3.7sec
rolled_ignite 20.3 21.6sec

Statistics & Data Analysis

DPS
Population
Convergence 71.53%
σ of the average dps 9.8748
2 * σ / μ 0.0793%
95% Confidence Intervall ( μ ± 2σ ) ( 24878.29 - 24917.78 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24868.41 - 24927.66 )
Sample Data
σ 987.4793
Minimum 21785.34
Maximum 28692.34
Spread ( max - min ) 6907.00
Range ( max - min ) / 2 3453.50
Range% 13.87
10th Percentile 23685.96
90th Percentile 26226.03
( 90th Percentile - 10th Percentile ) 2540.07
Approx. Iterations needed for
1% dps error 62
0.1% dps error 6291
0.1 scale factor error with delta=300 8667
0.05 scale factor error with delta=300 34670
0.01 scale factor error with delta=300 866769
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I frostfire_bolt
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIIIIIFIIIIIIIIIFGIDIIIIIIFIIIIIIIFIIGIIHIFIIIIIIFIIIIIIFIIIIIIFIIGIIIIFIIBIIHIIFIIIIIIFIIIIIIFGIDIIIIFIIIIIIFIAIEIHIIIFIIIIIIFGIIIIIIFIIGIIIIFIIIIIGBIFIHIIIIIFGIIGIIIFIIIGIDIFIIIIIJIFIIIIIIFHIIGIIIFIIIGIIGFIIIGIIIFGIIGIIIFIAIEIIIHGFIIIIIIIFGIIIIIIFDGIIIIGFIIIIIGIFIIIHIIGFIIIIGIIFIIIIIIFIIIGIIIFIIIIIIFIIHIIIIFGII9IIIIFIIIIIIFIII4IIIFIAIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_Frostfire_T11_372
origin="http://chardev.org/?profile=88851"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/frostfire/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/frostfire_bolt
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_T11_372 : 26123dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26123.0 19.96 / 0.08% 28.7 911.0 779.1 mana 0.00% 39.2
Origin http://chardev.org/?profile=88793
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • fireball
  • pyroblast
  • molten_armor

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56323|44042|39491|14480|9123|949&chds=0,112645&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF&chm=t++56323++flame_orb,C41F3B,0,0,15|t++44042++living_bomb,C41F3B,1,0,15|t++39491++pyroblast_hs,C41F3B,2,0,15|t++14480++fireball,C41F3B,3,0,15|t++9123++scorch,C41F3B,4,0,15|t++949++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:44,17,14,10,7,4,2,1,0,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=fireball|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t87777666555433333222211110zzzyyyyxxxxwwvvvvvuuuuuuttssssssssrrrrqqppppppoooonnmmmmmmlllllkkkjjjjjjjiiiihhhhhggggggfffeefjkkjjjjjiihhhhhhhggggfffeeeeeeeedddccccccbbbbbaaaZZZZZZZYYYXXWWWVVVVVUUUTTTSSSSSSRRRQQQQPPPPPPPOOONNNNNMMMMMLLLLKKKKKKJJLOPOOOONNNNNNMMMLLLLKKKKKKJJJJIIIIIIHHHHHGGGGFFFFFFFFEEEEEEDDDDDDDDDCCCCCCCDDDCCCDDDDDDDDEEEEEEEFFFFFGGGGGGGHHHHHHHIIIIIIIIIIIIIIIIIIIJJJJJKKKKKKLLLLLLMMMMMMMMNNNNNNNOOOOOOOOOPPPPPPPQQQQQRRRRRSSSSSSSSTTTTTTTTTUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116464&chtt=Mage_Fire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:jmnprstvwxy024677765310yxvusqonljihgeeddccccbbaaZaZZZabbaaaaaaaZaaabbaaZZYYXXXXYYYXXWWWWVVVWWXXXXXXXYYYYZZaaZZZZZYYYYYYYZYYYYYZZaabccccccdddeeefffffeeddddddddccbbaaaZZZZZZZYYYYYYYYZabbbccdddeeefffffeeedcbbbaaZZYYXXXWWWWXXXXXXXXXXXXXYYYYZZZZZZZaaabbbcccccccdddddeddddddddcccccccccccccccdccccccbbbbbbbaaZZZZYYYYZZZZZZZZZZZZZaaaaaaaaaaaaaabbbbbaaaaaaaaaZZZZZYZZZZaabbccddeffghiijjjjjjjjjjjjiihhggfeeeddddccccbbbbbbbbbabbbbbbbcccccdddddeeeeeeeddddddddddccc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26123|max=54349&chxp=1,1,48,100&chtt=Mage_Fire_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,2,2,4,4,10,11,24,46,61,89,86,128,170,249,320,342,441,460,491,583,582,648,590,589,587,560,508,437,401,306,256,239,194,147,123,96,56,49,35,24,16,14,5,4,3,3,0,2&chds=0,648&chbh=5&chxt=x&chxl=0:|min=22387|avg=26123|max=30073&chxp=0,1,49,100&chtt=Mage_Fire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_T11_372 26123
combustion 1795 6.9% 3.9 126.93sec 207483 180975 8229 17036 22952 31.4% 0.1% 0.0% 0.0% 54 10555 21967 31.8% 0.0% 8.7%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.91 3.91 54.21 54.21 1.1465 0.7252 811736
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 68.50% 8229.15 7082 11170 22052
crit 1.2 31.38% 17036.37 14552 22952 20912
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 37.0 68.22% 10554.54 3628 26827 390348
crit 17.2 31.78% 21967.37 7455 55125 378423

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13721.02
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.1 46.57sec 3078 0 2617 4045 4434 32.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.14 10.14 0.00 0.00 0.0000 0.0000 31209
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.35% 2617.21 2562 2870 17875
crit 3.3 32.50% 4045.48 3959 4434 13334
miss 0.0 0.15% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
fireball 11598 44.4% 206.3 2.18sec 25427 14480 18527 38198 54499 35.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
206.25 205.50 0.00 0.00 1.7560 0.0000 5244385
Direct Results Count Pct Average Min Max Total Damage
hit 131.9 64.21% 18526.58 16106 26522 2444547
crit 73.3 35.67% 38197.65 33096 54499 2799838
miss 0.3 0.13% 0.00 0 0 0

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.124000
  • base_dd_min:898.89
  • base_dd_max:1146.36
flame_orb 1075 4.1% 7.7 61.18sec 63395 56323 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.78 0.00 1.1256 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.91% 0.00 0 0 0
miss 0.0 0.09% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.22sec 7223 0 5476 11240 14777 30.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55328
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.47% 5475.63 4925 7191 29139
crit 2.3 30.42% 11239.77 10121 14777 26190
miss 0.0 0.12% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 953 3.6% 114.8 3.71sec 3753 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2819 5832 31.1% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.78 0.00 0.00 114.78 0.0000 0.0000 430752
Tick Results Count Pct Average Min Max Total Damage
hit 78.9 68.76% 2818.68 2437 3893 222480
crit 35.7 31.11% 5832.45 5008 7999 208273
miss 0.1 0.13% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 4397 16.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 208 9552 0 0.0% 0.0% 92.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 178.59 208.16 208.16 0.0000 2.0000 1988453
Direct Results Count Pct Average Min Max Total Damage
hit 178.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 208.2 100.00% 9552.29 745 53496 1988453

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:15307.56
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4069 15.6% 35.8 12.83sec 51435 44042 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6550 13521 30.8% 0.0% 93.2%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.77 35.77 185.93 185.93 1.1679 2.2658 1617335
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.6 69.18% 6549.99 5492 10800 842499
crit 57.3 30.82% 13520.80 11286 22191 774835

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 492 1.9% 35.7 12.68sec 6230 0 4716 9728 13716 30.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.73 35.73 0.00 0.00 0.0000 0.0000 222613
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 69.55% 4716.37 4154 6675 117206
crit 10.8 30.33% 9727.99 8536 13716 105408
miss 0.0 0.12% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2664 10.2% 26.1 16.83sec 46089 39491 21896 45118 64225 40.7% 0.1% 0.0% 0.0% 115 2356 4860 40.8% 0.0% 58.2%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.13 26.04 115.21 115.21 1.1671 2.2835 1204428
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 59.22% 21896.26 19113 31256 337662
crit 10.6 40.66% 45117.90 39274 64225 477744
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 68.2 59.23% 2355.75 1985 3898 160751
crit 47.0 40.77% 4859.77 4079 8010 228270

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 5.37sec 11169 9123 8811 18202 23493 25.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2242 0.0000 1704
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 74.77% 8811.23 7718 12010 1005
crit 0.0 25.16% 18202.14 15859 23493 699
miss 0.0 0.07% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 573
mirror_fire_blast 117 20.5% 34.3 33.52sec 1221 0 1175 1762 2220 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.29 34.29 0.00 0.00 0.0000 0.0000 41884
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.04% 1174.76 1105 1480 35873
crit 3.4 9.94% 1762.30 1658 2220 6010
miss 0.3 1.01% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 456 79.5% 85.7 12.83sec 1897 949 2028 3042 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.74 77.16 0.00 0.00 2.0000 0.0000 162674
Direct Results Count Pct Average Min Max Total Damage
hit 68.8 89.16% 2028.16 1912 2537 139542
crit 7.6 9.85% 3042.35 2868 3631 23132
miss 0.8 0.98% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_T11_372
fireball mana 73.6% 17.3 1471
flame_orb mana 1.8% 66.2 957
living_bomb mana 23.6% 18.9 2715
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29487.9 16.3 0.0%
clearcasting none 25.1 39484.4 1572.8 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 565.0 102824.4 182.0 0.0%
mana_gem mana 3.0 36306.1 12102.0 0.0%
master_of_elements mana 119.9 44774.7 373.3 0.0%
mp5_regen mana 1809.6 78684.7 43.5 0.0%
replenishment mana 1809.6 54387.6 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 207.2 0.0 2.2sec 2.2sec 79% 79%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 26.2 1.4 16.9sec 15.9sec 11% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 31% 31%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 518.2sec 518.2sec 69% 70%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 48.1sec 48.1sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 114.9sec 114.9sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.6sec 414.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.9 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.8sec
munched_ignite 93.8 4.8sec
rolled_ignite 16.8 25.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.25%
σ of the average dps 9.9821
2 * σ / μ 0.0764%
95% Confidence Intervall ( μ ± 2σ ) ( 26103.08 - 26143.01 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26093.10 - 26152.99 )
Sample Data
σ 998.2121
Minimum 22386.73
Maximum 30073.39
Spread ( max - min ) 7686.66
Range ( max - min ) / 2 3843.33
Range% 14.71
10th Percentile 24909.55
90th Percentile 27467.34
( 90th Percentile - 10th Percentile ) 2557.79
Approx. Iterations needed for
1% dps error 58
0.1% dps error 5840
0.1 scale factor error with delta=300 8857
0.05 scale factor error with delta=300 35428
0.01 scale factor error with delta=300 885713
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I fireball
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIGIDIIFGIIIIIIIIFGIIIIIIGIFIIIIGIIIFIIIGIHIFIIGIIIGFIIIIIIFIIGIIIIFIIIIGIIFIBIIHIIIFIIIIIIFGIDIIIIFIIIIGIIFGIIGIIIAEFIHIIGIIIFIIIIIIFIIIIIGIFIIIIGIIFIIIBIIIFGHIIIIIFGIIIIDIFIIIIIIFIIIIIIFGIIIIIIFGHIIIIIFJIIGIIGFIIGIIGIFIIIIIIFGIAEIIIGIFHIIIIIIFIIIIIIFIIIIIGIFDIIIIIGFIIIIIHIFGIIIIIIFIIIIIIFIIIIIIFIIIIIIFIIIIHGIFIIII9IIFIIIIIIFIIIIIIFGIDIIAI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_T11_372
origin="http://chardev.org/?profile=88793"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/fireball/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/fireball
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_Frostfire_T11_372 : 25103dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25103.0 11.55 / 0.05% 27.8 901.5 760.8 mana 0.01% 42.9
Origin http://chardev.org/?profile=87205
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • ice_lance
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:78622|34929|31085|19939|13719|2434|988&chds=0,157245&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++78622++deep_freeze,2459FF,0,0,15|t++34929++frostfire_orb,2459FF,1,0,15|t++31085++ice_lance,2459FF,2,0,15|t++19939++frostbolt,2459FF,3,0,15|t++13719++frostfire_bolt,2459FF,4,0,15|t++2434++water_bolt,2459FF,5,0,15|t++988++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:37,23,13,10,7,5,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostfire_bolt|ice_lance|deep_freeze|water_bolt|ignite|frostbolt|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t87766665555544444332111100000zzzyyyxxxwwwvvvuuuutttssssrrrrrqqqqppppooonnnnnmmmmmllllkkkkkjjjjjjjiiiihhhhhggggggggffffegjkkkjjjjjiiiiihhhhhhgggggggfffffeeeeeedddddcccccbbbbbbaaaaaaZZYYYYYXXXXXXXWWWWWWVVVVVVUUUUUTTTSSSSRRRRQQQQQPPPPOOONNNNNNPRSSSSRRRRRRQQQQQQPPPPPPPOOOOOONNNNNNNNMMMMMMLLLLLLLLLLLKKKKKKKKKKKKJJJJJJJJJJJJJJJJKKKKKKKKLLLLLLMMMMMMMNNNNNNNNNNOOOOOOOOOOOOOOOOPPPPPPQQQQRRRRSSSSSTTTTTUUUUUUUVVVVVVVWWWWWWWWWWXXXXXXXYYYYYYZZZZZZaaaaaaaaaaaaa&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118832&chtt=Mage_Frost_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:34466777654767023210ywuxxvtrqqponnmnlllklmoplklllmmmmostuvvvvwvuttuuvvxxxyvtrrppponmmkklllkjjjjjjjkklklkkkkkjihhggffeeefffgghijkklllllmmmmmllkkjjihhghhhhiiijjjjjjjjiihhhgfeeddccbccdfgijklmopqqssssssrrqpnmlkjjiiihihiijkjkkllllllllllkkkkkjkjjjkklmmnnonnnnnmmllllllkjjihggffffffgghhhihihihiiijjjjjihggfeeeeeeffgghhhhiiijjkkkkkkkkjjiihhgggggggggghhhhhhhhhhhhhhggggggghhijkmnoprrttuuuuuuttsrqonlkihfeedddddedeeeffgfggghhhhhgggggghhiijjkllmmnnnnnnopppppppoon&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25103|max=40078&chxp=1,1,63,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,4,0,6,12,19,20,42,51,88,97,169,148,218,288,350,439,466,474,534,546,620,591,595,592,557,499,487,401,354,301,262,186,148,119,88,65,42,41,31,19,12,4,4,4,1,2,2,1&chds=0,620&chbh=5&chxt=x&chxl=0:|min=23022|avg=25103|max=27436&chxp=0,1,47,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_Frostfire_T11_372 25103
cold_snap 0 0.0% 1.5 386.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.49 1.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 46.80sec 3074 0 2609 4036 4434 33.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31063
Direct Results Count Pct Average Min Max Total Damage
hit 6.7 65.98% 2609.46 2562 2870 17399
crit 3.4 33.50% 4035.91 3959 4434 13664
miss 0.1 0.52% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3290 13.1% 16.1 28.78sec 92521 78622 42786 94332 151697 96.9% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.08 16.08 0.00 0.00 1.1768 0.0000 1487760
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 2.54% 42786.37 39611 63277 17504
crit 15.6 96.93% 94331.87 81395 151697 1470257
miss 0.1 0.53% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 1226 4.9% 27.6 16.51sec 20059 19939 15069 31223 41335 31.8% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.63 27.54 0.00 0.00 1.0060 0.0000 554182
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 67.67% 15069.04 13668 20116 280852
crit 8.8 31.79% 31223.45 28086 41335 273330
miss 0.1 0.54% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 9282 37.0% 175.9 2.54sec 23862 13719 17158 35984 70339 32.9% 0.5% 0.0% 0.0% 192 459 948 32.7% 0.0% 97.8%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.89 175.33 191.89 191.89 1.7394 2.3047 4197278
Direct Results Count Pct Average Min Max Total Damage
hit 116.7 66.54% 17157.97 15631 29207 2001847
crit 57.7 32.92% 35983.58 32119 70339 2076648
miss 0.9 0.54% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.2 67.34% 459.22 184 784 59336
crit 62.7 32.66% 948.44 377 1612 59447

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:376.40
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 835 3.3% 9.0 51.53sec 41985 34929 0 0 0 0.0% 0.5% 0.0% 0.0% 123 0 0 0.0% 0.0% 27.1%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.99 8.99 122.53 0.00 1.2020 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.47% 0.00 0 0 0
miss 0.0 0.53% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 835 3.3% 122.5 3.50sec 3080 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2296 4768 32.2% 0.5% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.53 0.00 0.00 122.53 0.0000 0.0000 377355
Tick Results Count Pct Average Min Max Total Damage
hit 82.4 67.27% 2295.70 2057 2934 189237
crit 39.5 32.20% 4767.50 4228 6029 188118
miss 0.6 0.53% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 5751 22.9% 71.8 6.30sec 36240 31085 0 36505 57773 99.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
71.75 71.62 0.00 0.00 1.1658 0.0000 2600395
Direct Results Count Pct Average Min Max Total Damage
crit 71.2 99.47% 36505.17 31440 57773 2600395
miss 0.4 0.53% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1723 6.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 186 4194 0 0.0% 0.0% 82.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 131.72 185.72 185.72 0.0000 2.0000 778956
Direct Results Count Pct Average Min Max Total Damage
hit 131.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 185.7 100.00% 4194.28 56 21450 778956

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3218.86
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 596
mirror_fire_blast 122 20.5% 34.2 33.52sec 1274 0 1226 1838 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.23 34.23 0.00 0.00 0.0000 0.0000 43603
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.06% 1225.53 1105 1625 37361
crit 3.4 9.92% 1838.43 1657 2437 6242
miss 0.4 1.02% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 474 79.5% 85.6 12.82sec 1977 988 2113 3170 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.58 77.02 0.00 0.00 2.0000 0.0000 169173
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.10% 2112.69 1912 2778 144983
crit 7.6 9.91% 3169.87 2867 4167 24189
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2460
freeze 27 1.1% 17.0 27.42sec 713 0 540 1078 1136 33.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12117
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 65.86% 539.84 529 588 6044
crit 5.6 33.13% 1078.41 1055 1136 6073
miss 0.2 1.02% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2433 98.9% 205.7 2.19sec 5343 2434 4045 8135 10724 33.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.68 204.57 0.00 0.00 2.1949 0.0000 1098990
Direct Results Count Pct Average Min Max Total Damage
hit 134.1 65.56% 4045.03 3682 5376 542532
crit 68.4 33.44% 8135.05 7346 10724 556459
miss 2.0 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_Frostfire_T11_372
deep_freeze mana 6.2% 59.0 1567
frostbolt mana 13.8% 9.8 2037
frostfire_bolt mana 59.4% 17.3 1377
frostfire_orb mana 2.1% 44.7 940
ice_lance mana 16.5% 38.6 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29459.4 16.3 0.1%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 462.2 82172.8 177.8 0.0%
mana_gem mana 3.0 36305.6 12101.9 0.0%
master_of_elements mana 153.6 57313.1 373.1 0.0%
mp5_regen mana 1809.6 78609.4 43.4 0.1%
replenishment mana 1809.6 54307.6 30.0 0.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.5sec 187.5sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 4.1 0.0 82.6sec 82.6sec 0% 2%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 200.1 0.0 2.2sec 2.2sec 70% 70%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 33.6 48.1 13.6sec 5.5sec 77% 98%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.0sec 104.0sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 244.8sec 244.8sec 25% 26%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.3 0.0 426.1sec 426.1sec 75% 75%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 114.2sec 114.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 65.2sec 65.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.8sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 27.7 16.5sec
mana_gem 3.0 120.8sec
munched_ignite 32.2 13.5sec
rolled_ignite 10.5 38.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.13%
σ of the average dps 5.7758
2 * σ / μ 0.0460%
95% Confidence Intervall ( μ ± 2σ ) ( 25091.44 - 25114.55 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25085.67 - 25120.32 )
Sample Data
σ 577.5783
Minimum 23022.44
Maximum 27435.75
Spread ( max - min ) 4413.31
Range ( max - min ) / 2 2206.66
Range% 8.79
10th Percentile 24387.58
90th Percentile 25856.25
( 90th Percentile - 10th Percentile ) 1468.67
Approx. Iterations needed for
1% dps error 21
0.1% dps error 2117
0.1 scale factor error with delta=300 2965
0.05 scale factor error with delta=300 11861
0.01 scale factor error with delta=300 296530
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*15)<target.time_to_die
M frostbolt,if=!cooldown.early_frost.remains
N frostfire_bolt
O ice_lance,moving=1
P fire_blast,moving=1

Sample Sequence

01359BJDEHMNNNNNNNNJNMNNJKKNJNNJNHMNNNFGNNNNNNNNKKMJNNNANDNHCDGHMNNJNJJJKNKJNMNNNNNJNNHMNNJKKJNNNMNJNBJNNDJHNJJJKKMJJNNNNNNNMNNHNNNJNNMNNJNNNENDMNHNJKJJNNNMNJNJGNNNJNJKMNHNNNNNFJNNMNLNBNNNDNJNHMJNJNNNNNNMNNJNNNNHNMNNNNNNKNJMNDNNJNHNJ4JMNNKNJNNNJMNNNNHNNNMNGNJNJNEJNDNMNJNNNHNKNJMJINNNJNNNMNNNHKJFNNNMNNNNNNDNJMNKKJHNNJNNCDGHMJNJJNNJKNKKLJMNNNNNNNNMNHNNJKJNNMNNJNNDNJNJMHKNJJNNJNNMNJNNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.47% 16.47% 1687
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.05% 14.05% 1687
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.43% 7.43% 973

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_Frostfire_T11_372
origin="http://chardev.org/?profile=87205"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/ice_lance/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*15) actions+=/frostbolt,if=!cooldown.early_frost.remains
actions+=/frostfire_bolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1687
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=973
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_T11_372 : 26037dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26037.5 10.50 / 0.04% 20.8 1253.6 1096.6 mana 0.02% 48.7
Origin http://chardev.org/?profile=87885
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • frostbolt
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:77866|39042|35377|29605|15187|2414|990&chds=0,155732&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++77866++deep_freeze,2459FF,0,0,15|t++39042++frostfire_bolt,2459FF,1,0,15|t++35377++frostfire_orb,2459FF,2,0,15|t++29605++ice_lance,2459FF,3,0,15|t++15187++frostbolt,2459FF,4,0,15|t++2414++water_bolt,2459FF,5,0,15|t++990++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:40,18,12,11,9,4,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostbolt|ice_lance|deep_freeze|frostfire_bolt|water_bolt|ignite|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776655544433222110zzzyyxxwwwwvvuttssrrqqpoonnmmllkkjjjjiihhggggffeeeddcccbbbaaaZZZYYXXXWWWVVVUUUTTTTSSSSSSSSSSSSRRRRRRSWXWWWWWWWWWWVVVVVVVVVVVVVVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVWVVVWWWWWWWXXXXXXXXXXXXXXXXXXXXXXXWWWWWWWWWWVVVVVVVVUUUVXaaaaaaaabbbbbbbbbaaaaaaaaaaaaZZZZZZZZZZZYYYYYYYYYYXXXXXXXXXXXWWWWWWWWWVVVVVVVVVVUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTSSSSSSRRRRRQQQQQQQPPPPPPPPPPPPPPPPPPPPPPPPPPPOOOOOOOOOOOONNNNNNNMMMMMMMMMLLLMMMMMMMMMMMMMMMMMMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118835&chtt=Mage_Frost_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13355676654768133210yxvxwusrppoommmnlmlllmoolklllmmnmoqrrtsttttssstuuuvvvwussrqpponmmllkkkjiiiiiiijjjjjjjjjjihhhggffeeedeeffgghiijjkkkkkkklkkkjjiihggggggghhhhihhhhhggggfffeedcbbbbbcdeggijklmnoppppqqppoonmlkjjihhgggghhiijjjjjkkkkkkkkkkkkkkkkjjkklkllllllllkkkkjjjjjiihhggfffefefffffgggggghhhihihihhgggffffeeffffffggghhiijjjjjkjkjjiiiihhhghgggggggghghhhhhhhhhhgggghhhiijklmnnppqqrsssssrrqqpnnlkjihgfeeeedddddeeefffffggggggggggghhiiijjjklllllllmmnnnnnnnmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26037|max=42514&chxp=1,1,61,100&chtt=Mage_Frost_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,1,1,1,4,5,5,10,16,28,39,60,84,132,171,219,292,356,484,537,566,590,659,694,658,663,607,552,503,450,371,307,256,201,134,116,73,50,30,28,26,7,7,3,1,1,1&chds=0,694&chbh=5&chxt=x&chxl=0:|min=23622|avg=26037|max=28093&chxp=0,1,54,100&chtt=Mage_Frost_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_T11_372 26037
cold_snap 0 0.0% 1.5 389.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.46 1.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 68 0.3% 10.1 46.99sec 3075 0 2610 4040 4434 32.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.06 10.06 0.00 0.00 0.0000 0.0000 30935
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.38% 2610.32 2562 2870 17696
crit 3.3 32.57% 4039.96 3959 4434 13239
miss 0.0 0.05% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3213 12.3% 15.9 29.16sec 91493 77866 43141 94098 151188 94.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.88 15.88 0.00 0.00 1.1750 0.0000 1452929
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 5.03% 43141.26 39444 63065 34435
crit 15.1 94.93% 94097.64 81052 151188 1418494
miss 0.0 0.05% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 10538 40.5% 230.4 1.95sec 20676 15187 14995 31074 41335 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
230.45 229.71 0.00 0.00 1.3614 0.0000 4764716
Direct Results Count Pct Average Min Max Total Damage
hit 147.4 64.17% 14995.25 13668 20116 2210274
crit 82.2 35.79% 31074.40 28086 41335 2554443
miss 0.1 0.04% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 2745 10.5% 27.3 16.14sec 45456 39042 20101 44088 70103 94.5% 0.0% 0.0% 0.0% 122 361 742 71.5% 0.0% 61.4%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.30 27.22 121.60 121.60 1.1643 2.2832 1240989
Direct Results Count Pct Average Min Max Total Damage
hit 1.5 5.45% 20101.12 18456 29333 29794
crit 25.7 94.52% 44087.90 37924 70103 1134192
miss 0.0 0.04% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 34.6 28.49% 361.13 205 869 12511
crit 87.0 71.51% 741.62 421 1786 64492

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:469.59
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 842 3.2% 9.0 51.77sec 42508 35377 0 0 0 0.0% 0.0% 0.0% 0.0% 124 0 0 0.0% 0.0% 27.4%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.95 8.95 123.81 0.00 1.2016 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.95% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 842 3.2% 123.8 3.46sec 3073 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2296 4782 31.3% 0.0% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.81 0.00 0.00 123.81 0.0000 0.0000 380509
Tick Results Count Pct Average Min Max Total Damage
hit 85.0 68.64% 2295.58 2057 2934 195078
crit 38.8 31.32% 4782.43 4228 6029 185432
miss 0.1 0.05% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 4679 18.0% 61.2 7.37sec 34568 29605 0 34650 54837 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.21 61.09 0.00 0.00 1.1676 0.0000 2115827
Direct Results Count Pct Average Min Max Total Damage
crit 61.1 99.95% 34650.08 29816 54837 2115827
miss 0.0 0.05% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1044 4.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 169 2786 0 0.0% 0.0% 74.9%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 128.27 169.42 169.42 0.0000 2.0000 471934
Direct Results Count Pct Average Min Max Total Damage
hit 128.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 169.4 100.00% 2785.62 56 20483 471934

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:603.68
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 597
mirror_fire_blast 122 20.5% 34.2 33.50sec 1276 0 1228 1842 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.24 34.24 0.00 0.00 0.0000 0.0000 43708
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.15% 1227.78 1105 1625 37479
crit 3.4 9.88% 1841.65 1657 2437 6230
miss 0.3 0.97% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 475 79.5% 85.6 12.81sec 1980 990 2117 3174 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.61 77.04 0.00 0.00 2.0000 0.0000 169484
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.11% 2116.55 1912 2778 145303
crit 7.6 9.89% 3173.69 2867 4167 24181
miss 0.8 1.01% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2440
freeze 27 1.1% 17.0 27.42sec 707 0 540 1078 1172 32.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12017
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 66.91% 539.62 529 588 6139
crit 5.5 32.06% 1078.21 1055 1172 5878
miss 0.2 1.03% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2413 98.9% 205.7 2.19sec 5299 2414 4042 8141 10724 32.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.68 204.57 0.00 0.00 2.1949 0.0000 1089890
Direct Results Count Pct Average Min Max Total Damage
hit 136.3 66.65% 4042.35 3682 5376 551166
crit 66.2 32.35% 8140.53 7346 10724 538724
miss 2.0 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_T11_372
deep_freeze mana 4.4% 58.4 1567
frostbolt mana 82.8% 10.2 2037
frostfire_orb mana 1.5% 45.2 940
ice_lance mana 10.2% 36.8 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29500.7 16.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 1157.2 205415.7 177.5 0.0%
mana_gem mana 3.0 36313.0 12104.3 0.0%
master_of_elements mana 184.5 85674.4 464.3 0.0%
mp5_regen mana 1809.6 78717.4 43.5 0.0%
replenishment mana 1809.6 54351.0 30.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.3sec 187.3sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 27.6 7.0 16.0sec 12.7sec 18% 100%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 231.2 0.0 1.9sec 1.9sec 66% 66%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 46.6 46.7 9.8sec 4.9sec 66% 89%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.4sec 104.4sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.9 0.0 53.2sec 53.2sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.5 0.0 248.0sec 248.0sec 64% 64%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.6 0.0 277.4sec 277.4sec 36% 39%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.9sec 48.9sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 112.6sec 112.6sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 64.9sec 64.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 28.2 16.2sec
mana_gem 3.0 120.7sec
munched_ignite 26.4 15.9sec
rolled_ignite 11.6 34.8sec

Statistics & Data Analysis

DPS
Population
Convergence 71.28%
σ of the average dps 5.2481
2 * σ / μ 0.0403%
95% Confidence Intervall ( μ ± 2σ ) ( 26026.99 - 26047.99 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26021.75 - 26053.24 )
Sample Data
σ 524.8092
Minimum 23622.34
Maximum 28092.79
Spread ( max - min ) 4470.44
Range ( max - min ) / 2 2235.22
Range% 8.58
10th Percentile 25388.50
90th Percentile 26727.91
( 90th Percentile - 10th Percentile ) 1339.42
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1625
0.1 scale factor error with delta=300 2448
0.05 scale factor error with delta=300 9792
0.01 scale factor error with delta=300 244821
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*12)<target.time_to_die
M frostbolt
N ice_lance,moving=1
O fire_blast,moving=1

Sample Sequence

01359BJDEHMJJJJMMMMMJMJMMMMMJKMJMMMJMHMMMMMFGMIMMIMMMMMKKMJMMMMAMDJHCDGHMMMMMIMMJKKMJMJMMMIMMMIMHLMMMMMMIMJMJMMMMBJMMDJHMMKMMIMJMMMMMMJMMMIMMMMHMKMJMMIMMMMJMMEMMDJMJHKJMMJMMMMMJMMGJMMJMMKMJIMHMMMMMMFMIMMMIJMBMMKKDJMMJI4MHMMMMMMIMMMMIMJMMMMIMMHMMMMMMMIMKJMDMMMJIMJIMHMMJMJIMJMMIMMLMMMMMMMMMHMGMJIMMMEMMDJMMJMJIMMMMJKMHMMMMMMMMMMMMMMJKMMFJMMHMMMMMMMMDMIMMJKMJJJJMMHMMCDGHIMMMMMJMJKMJMMMMMMMMMJMMHMMMMIMJIMMMMMMMMMMIDMHMMIJJMMMJIMMMIMMJMMMIM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.96% 16.96% 1737
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.46% 14.46% 1737
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.23% 7.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_T11_372
origin="http://chardev.org/?profile=87885"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/frostbolt/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*12) actions+=/frostbolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1737
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Paladin_Retribution_T11_372 : 27424dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27423.6 15.41 / 0.06% 34.2 802.0 774.0 mana 6.02% 56.0
Origin http://chardev.org/?profile=47301
Talents http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
Glyphs
  • the_ascetic_crusader
  • hammer_of_wrath
  • templars_verdict
  • exorcism
  • seal_of_truth

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:31864|21879|21208|11484|9592|8112|8106|2691|2393&chds=0,63728&chco=C0C0C0,C0C0C0,C79C6E,C0C0C0,C79C6E,C0C0C0,C0C0C0,C79C6E,C79C6E&chm=t++31864++exorcism,C0C0C0,0,0,15|t++21879++hammer_of_wrath,C0C0C0,1,0,15|t++21208++templars_verdict,C79C6E,2,0,15|t++11484++consecration,C0C0C0,3,0,15|t++9592++crusader_strike,C79C6E,4,0,15|t++8112++holy_wrath,C0C0C0,5,0,15|t++8106++judgement_of_truth,C0C0C0,6,0,15|t++2691++melee,C79C6E,7,0,15|t++2393++melee,C79C6E,8,0,15&chtt=Paladin_Retribution_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:17,16,13,10,8,8,7,5,5,4,4,1,1,1,0&chds=0,100&chco=C79C6E,C0C0C0,C79C6E,C79C6E,C79C6E,C0C0C0,C0C0C0,C0C0C0,336600,C0C0C0,C0C0C0,C0C0C0,C79C6E,C0C0C0,C0C0C0&chl=templars_verdict|hand_of_light|crusader_strike|melee|seal_of_truth|exorcism|censure|hammer_of_wrath|darkmoon_card_hurricane|judgement_of_truth|seals_of_command|holy_wrath|melee|ancient_fury|consecration&chtt=Paladin_Retribution_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556776556544332111110zyyxxyyyzzzzzyyyxxxwwwwvvtsqoljhgdcbabbbaaaZZYYXYYYYXXWWVVVUUUUUTTSSSSRRRRRRRRQQQQQPQQQQQQQPPPPPPPPONNOOOOOPPPQQQQRRRSSSSSSSSSSSSSSTTTUUVVWWWXXXXXXXXXXWWVVUUUUTTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSRSRRRRRRRRRRRRRRRRRQRRRRRQPPPPPPQQRRRRSSSSTTTTTTTTTTTTTSSTTTTTTUUUUUVVVVVVVWWWWWWWWVVVVVVUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUTSSTTTTTUUUUVVVVWWWWWWWWWWWWWWWWWWXXXXXXYYYYZZZZaaaabbbbbbbbbbbbbbbcccccccccdddddddddddd&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=24568&chtt=Paladin_Retribution_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y011223354567676576456544210zwwvuvvutusrrpmlkjjjjkjjiiihhhghhghhgggffededddccccccbbbccccdddeeeeeeeeefeeeeeeddddeefggghhhijjkklmmnoopoonnnmmlkkjjiihhhhhhhhhiijjklllmmmmmmmlllkjjiihggfeedddccccbbbbbbccccccdddeeefffffffffffffefeeeeddddeeefffgghhijjkklmmnnonnnmmlllkjjjiiihhhhhhhiiijjjkkklllllllkkkkkjjjjiiiiiiiiiijjjjkkkllmmnppppppooonnnmmlkkkjjhffeeeeeeefffgghhijjkklmmnnoopppppooonmmmllkkkjjjiiiiiiijjjkkkkllllmmmmmmmmmmmllllllkkkkkkkkkjkjjjjjjjjjjjjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27424|max=45272&chxp=1,1,61,100&chtt=Paladin_Retribution_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,0,3,4,3,6,11,24,36,53,77,81,134,189,257,340,399,457,633,613,695,647,706,680,644,601,492,473,368,335,275,185,159,136,90,69,39,31,16,15,5,7,4,2,1,1,0,2&chds=0,706&chbh=5&chxt=x&chxl=0:|min=24190|avg=27424|max=30820&chxp=0,1,49,100&chtt=Paladin_Retribution_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Paladin_Retribution_T11_372 27424
ancient_fury 208 0.8% 3.0 210.50sec 31346 0 28521 60294 103079 9.5% 0.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 94038
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 89.77% 28520.91 0 50038 76813
crit 0.3 9.52% 60293.69 0 103079 17226
dodge 0.0 0.70% 0.00 0 0 0

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Fury, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.061000
  • base_dd_min:207.04
  • base_dd_max:280.11
censure 2025 7.4% 395.0 1.15sec 2317 0 0 0 0 0.0% 0.7% 0.0% 0.0% 196 4233 8716 9.8% 0.0% 99.8%

Stats details: censure

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
395.05 395.05 195.86 195.86 0.0000 2.3044 915353
Direct Results Count Pct Average Min Max Total Damage
hit 392.2 99.29% 0.00 0 0 0
dodge 2.8 0.71% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 176.6 90.17% 4232.61 693 6761 747469
crit 19.3 9.83% 8716.21 1427 13928 167884

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Holy damage every $t1 sec.
  • description:Holy damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
consecration 131 0.5% 4.3 94.44sec 13835 11484 0 0 0 0.0% 0.0% 0.0% 0.0% 53 1019 1574 17.2% 0.0% 9.3%

Stats details: consecration

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.27 4.27 52.97 52.97 1.2047 0.7913 59041
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 43.9 82.80% 1019.15 750 1439 44699
crit 9.1 17.20% 1574.47 1159 2201 14342

Action details: consecration

Static Values
  • id:81297
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:81.33
  • base_dd_max:81.33
crusader_strike 3583 13.1% 111.6 4.04sec 14513 9592 11493 23676 33559 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
111.62 111.62 0.00 0.00 1.5131 0.0000 1620038
Direct Results Count Pct Average Min Max Total Damage
hit 84.0 75.21% 11493.01 10593 16291 964844
crit 27.7 24.79% 23675.69 21823 33559 655194

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1639.4
  • cooldown:3.72
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.35
darkmoon_card_hurricane 1263 4.6% 93.0 5.38sec 6140 0 5562 11457 11458 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
92.98 92.98 0.00 0.00 0.0000 0.0000 570893
Direct Results Count Pct Average Min Max Total Damage
hit 83.9 90.20% 5561.88 5150 5562 466451
crit 9.1 9.80% 11457.45 10609 11458 104443

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
divine_plea 0 0.0% 3.2 131.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_plea

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.20 3.20 0.00 0.00 1.1991 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.2 100.00% 0.00 0 0 0

Action details: divine_plea

Static Values
  • id:54428
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • description:You gain $o1% of your total mana over $d, but the amount healed by your healing spells is reduced by $s2%.
exorcism 2289 8.3% 27.5 15.96sec 37704 31864 28911 44667 65765 17.4% 0.0% 0.0% 0.0% 79 1932 2984 17.2% 0.0% 34.8%

Stats details: exorcism

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.45 27.45 78.71 78.71 1.1833 2.0000 1035028
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 82.65% 28910.63 20656 42567 655904
crit 4.8 17.35% 44667.09 31914 65765 212803
Tick Results Count Pct Average Min Max Total Damage
hit 65.1 82.76% 1931.55 1380 2842 125824
crit 13.6 17.24% 2983.81 2132 4392 40497

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:7026.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Holy damage per $t2 sec.
  • description:Causes ${(($m1+$M1)/2)+(0.344*$cond($gt($SP,$AP),$SP,$AP))} Holy damage $?s54934[plus ${($m1+$M1)/2*0.0688} over $d ][]to an enemy target. If the target is Undead or Demon, it will always critically hit.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2590.76
  • base_dd_max:2892.33
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.066667
  • base_td:184.28
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
hammer_of_wrath 1421 5.2% 19.5 24.00sec 33021 21879 18969 39104 51898 69.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.45 19.45 0.00 0.00 1.5092 0.0000 642311
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 30.21% 18968.69 12395 25193 111477
crit 13.6 69.79% 39104.35 25533 51898 530834

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • tree:retribution
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • base_cost:-2810.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a hammer that strikes an enemy for $s1 Holy damage. Only usable on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:3814.27
  • base_dd_max:4215.78
hand_of_light 4255 15.5% 176.9 2.55sec 10875 0 10875 0 39962 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.89 176.89 0.00 0.00 0.0000 0.0000 1923641
Direct Results Count Pct Average Min Max Total Damage
hit 176.9 100.00% 10874.52 4240 39962 1923641

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:51409.17
  • base_dd_max:51409.17
holy_wrath 342 1.2% 15.9 26.30sec 9766 8112 8924 13802 18970 17.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.85 15.85 0.00 0.00 1.2040 0.0000 154810
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 82.73% 8923.75 6531 12278 117018
crit 2.7 17.27% 13802.41 10090 18970 37792

Action details: holy_wrath

Static Values
  • id:2812
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:4684.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:Sends bolts of holy power in all directions, causing ${0.61*$SPH+$m1} Holy damage divided among all targets within $a1 yds and stunning all Demons$?s56420[, Dragonkin, Elementals,][] and Undead for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.610000
  • base_dd_min:2435.78
  • base_dd_max:2435.78
inquisition 0 0.0% 12.2 38.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.16 12.16 0.00 0.00 1.1713 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • tree:retribution
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases Holy damage done by $s1%.
  • description:Consumes all Holy Power to increase your Holy Damage by $s1%. Lasts $d per charge of Holy Power consumed.
judgement_of_truth 980 3.6% 36.2 12.58sec 12237 8106 9936 20477 33880 21.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: judgement_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.21 36.21 0.00 0.00 1.5096 0.0000 443039
Direct Results Count Pct Average Min Max Total Damage
hit 28.3 78.17% 9935.72 5617 16447 281211
crit 7.9 21.83% 20477.10 11570 33880 161828

Action details: judgement_of_truth

Static Values
  • id:31804
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1171.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${1+0.223*$SPH+0.142*$AP} Holy damage to an enemy, increased by 10% for each application of Censure on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
melee 2685 9.8% 162.5 2.79sec 7470 2691 7151 14726 21084 9.9% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
162.49 162.49 0.00 0.00 2.7760 0.0000 1213819
Direct Results Count Pct Average Min Max Total Damage
hit 107.5 66.13% 7151.02 6573 10235 768427
crit 16.0 9.88% 14725.84 13539 21084 236311
glance 39.0 23.99% 5362.58 4929 7676 209081

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth 2326 8.5% 421.5 1.07sec 2495 0 2260 4655 6715 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
421.49 421.49 0.00 0.00 0.0000 0.0000 1051671
Direct Results Count Pct Average Min Max Total Damage
hit 380.1 90.17% 2259.65 358 3260 858784
crit 41.4 9.83% 4654.77 738 6715 192887

Action details: seal_of_truth

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3279.1
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
seals_of_command 976 3.6% 422.5 1.07sec 1045 0 946 1949 2798 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seals_of_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
422.50 422.50 0.00 0.00 0.0000 0.0000 441320
Direct Results Count Pct Average Min Max Total Damage
hit 380.9 90.16% 945.88 671 1358 360303
crit 41.6 9.84% 1948.52 1382 2798 81017

Action details: seals_of_command

Static Values
  • id:20424
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Seal of Righteousness, Seal of Truth and Seal of Justice now also deal $s1% weapon damage each time you swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.07
templars_verdict 4613 16.8% 65.3 6.84sec 31954 21208 25906 53393 76800 22.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
65.27 65.27 0.00 0.00 1.5067 0.0000 2085646
Direct Results Count Pct Average Min Max Total Damage
hit 50.9 78.00% 25906.28 23940 37281 1318868
crit 14.4 22.00% 53393.10 49317 76800 766778

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant weapon attack that causes a percentage of weapon damage. Consumes all charges of Holy Power to increase damage dealt: 1 Holy Power: $% Weapon Damage 2 Holy Power: $% Weapon Damage 3 Holy Power: $% Weapon Damage
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.35
pet - guardian_of_ancient_kings 445
melee 445 100.0% 34.0 9.99sec 4350 2393 4629 0 4629 0.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.00 34.00 0.00 0.00 1.8182 0.0000 147914
Direct Results Count Pct Average Min Max Total Damage
hit 25.8 75.95% 4628.68 4629 4629 119531
glance 8.2 24.05% 3471.51 3472 3472 28383

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Paladin_Retribution_T11_372
consecration mana 15.2% 1.1 12882
crusader_strike mana 50.5% 8.9 1639
holy_wrath mana 20.5% 2.1 4684
inquisition holy_power 16.2% 0.0 2
judgement_of_truth mana 11.7% 10.4 1171
templars_verdict holy_power 83.8% 16692.4 2
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29273.1 16.2 0.8%
divine_plea mana 114.4 9579.8 83.7 0.0%
holy_power_crusader_strike holy_power 111.6 147.4 1.3 0.9%
initial_mana none 1.0 25122.0 25122.0 0.0%
judgements_of_the_bold mana 1340.6 194549.2 145.1 0.9%
mp5_regen mana 1809.6 105277.1 58.2 0.6%
replenishment mana 1809.6 11277.7 6.2 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 89.5 300.7sec 3.6sec 13% 100%

Database details

  • id:86700
  • cooldown name:buff_ancient_power
  • tooltip:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.3 0.0 121.1sec 121.1sec 19% 20%

Database details

  • id:31884
  • cooldown name:buff_avenging_wrath
  • tooltip:All damage and healing caused increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 9.1 0.0 52.6sec 52.6sec 30% 30%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
divine_plea 3.2 0.0 131.6sec 131.6sec 6% 6%

Database details

  • id:54428
  • cooldown name:buff_divine_plea
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
divine_purpose 27.9 0.4 15.8sec 15.6sec 12% 34%

Database details

  • id:90174
  • cooldown name:buff_divine_purpose
  • tooltip:Next Holy Power ability consumes no Holy Power and casts as if 3 Holy Power were used.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:15.00%
golemblood_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
inquisition 4.0 8.2 117.4sec 38.7sec 97% 98%

Database details

  • id:84963
  • cooldown name:buff_inquisition
  • tooltip:Increases Holy damage done by $s1%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_bold 19.0 17.2 24.3sec 12.6sec 74% 74%

Database details

  • id:89906
  • cooldown name:buff_judgements_of_the_bold
  • tooltip:Regaining ${$m1/10}% of your base mana per second.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.5 9.0 35.8sec 20.2sec 44% 46%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
the_art_of_war 27.7 4.8 16.1sec 13.7sec 22% 100%

Database details

  • id:
  • cooldown name:buff_the_art_of_war
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
zealotry 3.9 0.0 125.4sec 125.4sec 17% 17%

Database details

  • id:85696
  • cooldown name:buff_zealotry
  • tooltip:Crusader Strike generates 3 charges of Holy Power.
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
guardian_of_ancient_kings-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
censure

Database details

  • id:31803
  • cooldown name:buff_censure
  • tooltip:Holy damage every $t1 sec.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_pure

Database details

  • id:53657
  • cooldown name:buff_judgements_of_the_pure
  • tooltip:Casting and melee speed increased by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 93.0 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 69.57%
σ of the average dps 7.7057
2 * σ / μ 0.0562%
95% Confidence Intervall ( μ ± 2σ ) ( 27408.23 - 27439.06 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27400.53 - 27446.76 )
Sample Data
σ 770.5747
Minimum 24190.37
Maximum 30820.30
Spread ( max - min ) 6629.94
Range ( max - min ) / 2 3314.97
Range% 12.09
10th Percentile 26496.32
90th Percentile 28449.63
( 90th Percentile - 10th Percentile ) 1953.31
Approx. Iterations needed for
1% dps error 31
0.1% dps error 3158
0.1 scale factor error with delta=300 5278
0.05 scale factor error with delta=300 21112
0.01 scale factor error with delta=300 527809
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 seal_of_truth
3 snapshot_stats
4 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
5 auto_attack
6 judgement,if=buff.judgements_of_the_pure.down
7 guardian_of_ancient_kings
8 avenging_wrath,if=buff.zealotry.down
9 zealotry,if=buff.avenging_wrath.down
A inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
B templars_verdict,if=holy_power=3
C crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
D templars_verdict,if=buff.divine_purpose.react
E crusader_strike
F hammer_of_wrath
G exorcism,if=buff.the_art_of_war.react
H judgement,if=buff.judgements_of_the_pure.remains<2
I wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
J judgement
K holy_wrath
L consecration
M divine_plea

Sample Sequence

01245678ABEFEGEBEFCDCB9BEBEBCBBEBEABEBGEJKELMIEBGEGJEKIIEBIIEJIIIIIEIIIIIEAJEKDEJEBIIGCDJCDKEBJCDIIIELGEABEJIIEG8DEBFEGJEFKIIIEBFEG9DEBAEBJCBBEBGEBIIIEJIIEKMEBJCDIIIIIEJEAKCDJEGIIIIIEBDEJKCDDEBIIEGDEJIIEAGEKDEJGEBDEJ8FCDKEBFEGJEFAEBDEGJEKIIIIIE9BGEBDEBGEBJEBGCAJE7KLEBJEMIIIIIEIIIGCBBEJIIEKIIIIIEBJEIIIIIEJAEBKEJIIGEIIIIIEBJEGKE8FIIEBIIEFDCDFEADEFGEJKEBIIIIIEJIIIIIEIIIIIE9BJEBKEBJEAGEBIIEBIIEJIIEKMEBFCDDEFGEBDEFAEJKEBFEJIIIIIEFIIEBIIEFIIEJIIEBD8EFJEKLFEAJEFIIIIIE4GJCBBEFDEGGEBDEFIIEJIIE9ABEBFEBG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7109 5784 5345
Agility 699 117 20
Stamina 7711 6086 5930
Intellect 132 126 20
Spirit 141 141 20
Health 150923 128229 0
Mana 25122 25032 0
Spell Power 5442 3708 0
Spell Hit 17.47% 17.47% 970
Spell Crit 14.08% 9.07% 993
Spell Haste 10.90% 5.61% 719
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 16086 11974 190
Melee Hit 8.08% 8.08% 970
Melee Crit 14.64% 6.77% 993
Melee Haste 5.61% 5.61% 719
Expertise 23.15 13.15 395
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.42% 4.51% 83
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.06% 19.06% 1982

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
tabard empty

Talents

Holy Rank
Arbiter of the Light 2
Protector of the Innocent 0
Judgements of the Pure 3
Clarity of Purpose 0
Last Word 0
Blazing Light 2
Denounce 0
Divine Favor 0
Infusion of Light 0
Daybreak 0
Enlightened Judgements 0
Beacon of Light 0
Speed of Light 0
Sacred Cleansing 0
Conviction 0
Aura Mastery 0
Paragon of Virtue 0
Tower of Radiance 0
Blessed Life 0
Light of Dawn 0
Protection Rank
Divinity 0
Seals of the Pure 2
Eternal Glory 0
Judgements of the Just 0
Toughness 0
Improved Hammer of Justice 0
Hallowed Ground 0
Sanctuary 0
Hammer of the Righteous 0
Wrath of the Lightbringer 0
Reckoning 0
Shield of the Righteous 0
Grand Crusader 0
Vindication 0
Holy Shield 0
Guarded by the Light 0
Divine Guardian 0
Sacred Duty 0
Shield of the Templar 0
Ardent Defender 0
Retribution Rank
Eye for an Eye 2
Crusade 3
Improved Judgement 2
Guardian's Favor 0
Rule of Law 3
Pursuit of Justice 2
Communion 1
The Art of War 3
Long Arm of the Law 2
Divine Storm 1
Sacred Shield 1
Sanctity of Battle 1
Seals of Command 1
Sanctified Wrath 3
Selfless Healer 0
Repentance 1
Divine Purpose 2
Inquiry of Faith 3
Acts of Sacrifice 0
Zealotry 1

Profile

#!./simc

paladin=Paladin_Retribution_T11_372
origin="http://chardev.org/?profile=47301"
level=85
race=human
role=hybrid
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
glyphs=the_ascetic_crusader/hammer_of_wrath/templars_verdict/exorcism/seal_of_truth
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/seal_of_truth
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
actions+=/auto_attack
actions+=/judgement,if=buff.judgements_of_the_pure.down
actions+=/guardian_of_ancient_kings
actions+=/avenging_wrath,if=buff.zealotry.down
actions+=/zealotry,if=buff.avenging_wrath.down
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
actions+=/templars_verdict,if=holy_power=3
actions+=/crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
actions+=/templars_verdict,if=buff.divine_purpose.react
actions+=/crusader_strike
actions+=/hammer_of_wrath
actions+=/exorcism,if=buff.the_art_of_war.react
actions+=/judgement,if=buff.judgements_of_the_pure.remains<2
actions+=/wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
actions+=/judgement
actions+=/holy_wrath
actions+=/consecration
actions+=/divine_plea
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders=reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
chest=reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs=reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands=reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
# Gear Summary # gear_strength=5345
# gear_agility=20
# gear_stamina=5930
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=395
# gear_hit_rating=970
# gear_crit_rating=993
# gear_haste_rating=719
# gear_mastery_rating=1982
# gear_armor=21168
# gear_dodge_rating=83
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide

Priest_Disc_Smite_T11_372 : 11185dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
11185.4 104.89 / 0.94% 6.2 1818.0 1633.1 mana 28.48% 31.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGszRsbcRMo0hZhb0b
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:29397|26120|24208|17237|16123|12222|7733&chds=0,58794&chco=9482C9,9482C9,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9&chm=t++29397++devouring_plague,9482C9,0,0,15|t++26120++shadow_word_pain,9482C9,1,0,15|t++24208++power_word_shield,C0C0C0,2,0,15|t++17237++penance,C0C0C0,3,0,15|t++16123++holy_fire,C0C0C0,4,0,15|t++12222++smite,C0C0C0,5,0,15|t++7733++melee,9482C9,6,0,15&chtt=Priest_Disc_Smite_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:31,29,26,14,13,13,11,5,4,1&chds=0,100&chco=C0C0C0,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9,9482C9,C0C0C0,9482C9,C41F3B&chl=penance|atonement|smite|holy_fire|power_word_shield|shadow_word_pain|devouring_plague|divine_aegis|melee|darkmoon_card_volcano&chtt=Priest_Disc_Smite_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556677764565433554200zxvuuvvvwxxywvvuuuwyxxwvuutrsstrqnooonoqstuvwxyvvvwwwwvvvvusrssrqppppoopppoprstvxy0000011110zyxuttssrstuuusrrsttvutssrqpooopmlmllljjjkllmmmnnmmlkllkkkkkiihggfeeddddccbbbbddefeecccbbbbaaZYWVUUUUUVVWVVUTUVWVVUUTRRQRQOONMMLKKKKJJKLMMNNNOOMLKKKKJJJJIHHGFFFFEEEEEEEEDEGHHGGFFEDDCCCCCCBBBBBBBBBBBBBBBCCCCCCBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCEHJKMNOQRRSSSTTTSSSSSSRRSSSSRRRQQPPRTVXZbdfgghhhhiiiihhgfeddddddccbbaZZZZZZZaaZZYYYXXXXXXWW&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=125176&chtt=Priest_Disc_Smite_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:0222345543445577441yvspmkiihhfecbbcbcdaZacdhikjhigjlnpnnnmkmnmoolkjjkijiggfghkjjhffeccddfgihhghhiiiklmmnnnopnlllnmmjhffccdeeedfedffecacehjkjkjhgijkihhfdddfddbYaabbbbaZabdfghgfeeefgggffffffefeeeefghhhihhghiihhfecbaabcdddccddeeedefhijlkjjiiiiigfedddeecbbbabbbbbbbcdefeedcbcccbaZZaaaaaaaaabbbcccbbcbbbaZYXWVUTSRRQRRRRRRRRRRSSSSSSSSSTTSSRRQQPPPPPPOOONNNNOOOOOOOOOPPPQRTUWXYYZabbdeefffffffeedddcbaaYYYYZZZZaabbcbbbbcefghihhhhijjkjjjiihhhggffffeedcbaaaZZaabb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=11185|max=22203&chxp=1,1,50,100&chtt=Priest_Disc_Smite_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,1,2,5,9,18,24,32,35,43,71,108,119,145,188,246,322,340,408,479,510,572,576,622,648,639,609,591,505,459,379,325,256,226,135,121,68,51,45,25,12,6,7,8,1,3,0,1,1&chds=0,648&chbh=5&chxt=x&chxl=0:|min=14686|avg=11185|max=18142&chxp=0,1,-101,100&chtt=Priest_Disc_Smite_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Disc_Smite_T11_372 11185
archangel 0 0.0% 12.5 35.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.46 12.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.5 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
atonement 3260 29.1% 72.6 6.11sec 20313 0 17861 27932 44907 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: atonement

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.59 72.59 0.00 0.00 0.0000 0.0000 1474640
Direct Results Count Pct Average Min Max Total Damage
hit 54.9 75.65% 17860.72 12678 29066 980832
crit 17.7 24.35% 27931.59 19588 44907 493808

Action details: atonement

Static Values
  • id:81751
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:(null)
  • description:When you deal damage with Smite, you instantly heal a nearby low health friendly party or raid target within $81751A yards from the enemy target equal to a percentage of the damage dealt.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:19202.31
  • base_dd_max:19202.31
darkmoon_card_volcano 72 0.6% 10.2 46.58sec 3218 0 2812 4347 4543 26.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.17 10.17 0.00 0.00 0.0000 0.0000 32712
Direct Results Count Pct Average Min Max Total Damage
hit 7.5 73.57% 2811.74 2773 2940 21029
crit 2.7 26.43% 4347.24 4284 4543 11683

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1221 10.9% 16.5 27.54sec 33542 29397 0 0 0 0.0% 0.0% 0.0% 0.0% 176 2763 4301 24.0% 0.0% 82.5%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.47 16.47 176.36 176.36 1.1410 2.1168 552415
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.1 76.02% 2763.48 2566 3398 370474
crit 42.3 23.98% 4301.44 3965 5250 181941

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_aegis 506 4.5% 17.7 24.72sec 12953 0 12953 0 22999 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.68 17.68 0.00 0.00 0.0000 0.0000 229000
Direct Results Count Pct Average Min Max Total Damage
hit 17.7 100.00% 12953.05 8645 22999 229000

Action details: divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Critical heals have a chance to create a protective shield on the target, absorbing a percentage of the amount healed. Lasts $d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:6478.21
  • base_dd_max:6478.21
holy_fire 1582 14.1% 38.4 11.90sec 18648 16123 11612 18084 23631 24.0% 0.0% 0.0% 0.0% 373 497 774 24.1% 0.0% 59.0%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.37 38.37 373.15 373.15 1.1566 0.7150 715565
Direct Results Count Pct Average Min Max Total Damage
hit 29.2 75.97% 11611.99 8408 15295 338524
crit 9.2 24.03% 18084.16 12991 23631 166720
Tick Results Count Pct Average Min Max Total Damage
hit 283.3 75.93% 497.05 363 656 140828
crit 89.8 24.07% 773.66 561 1014 69493

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
penance 3468 31.0% 36.8 12.33sec 42612 17237 0 0 0 0.0% 0.0% 0.0% 0.0% 151 9197 14301 24.4% 0.0% 18.1%

Stats details: penance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.82 36.82 150.57 150.25 2.4721 0.5436 1568811
Direct Results Count Pct Average Min Max Total Damage
none 36.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 113.6 75.62% 9196.61 6654 12142 1044910
crit 36.6 24.38% 14300.84 10281 18760 523901

Action details: penance_tick

Static Values
  • id:47666
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.458000
  • base_dd_min:699.38
  • base_dd_max:790.24

Action details: penance

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • tree:discipline
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2882.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
power_infusion 0 0.0% 4.3 122.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.26 4.26 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3294.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
power_word_shield 1463 13.1% 23.9 18.86sec 27650 24208 27650 0 37307 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.94 23.94 0.00 0.00 1.1422 0.0000 661798
Direct Results Count Pct Average Min Max Total Damage
hit 23.9 100.00% 27649.70 25660 37307 661798

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6300.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $ damage. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.870000
  • base_dd_min:8136.94
  • base_dd_max:8136.94
shadow_fiend 0 0.0% 1.9 300.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.90 1.90 0.00 0.00 1.1800 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1435 12.8% 21.8 20.82sec 29789 26120 0 0 0 0.0% 0.0% 0.0% 0.0% 184 3112 4855 24.1% 0.0% 86.4%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.80 21.80 183.79 183.79 1.1405 2.1266 649256
Direct Results Count Pct Average Min Max Total Damage
hit 21.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 139.5 75.88% 3112.17 2882 3787 434061
crit 44.3 24.12% 4855.17 4452 5851 215196

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 2915 26.1% 72.6 6.11sec 18164 12222 15968 24984 39933 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.59 72.59 0.00 0.00 1.4861 0.0000 1318578
Direct Results Count Pct Average Min Max Total Damage
hit 54.9 75.65% 15967.71 11612 25847 876876
crit 17.7 24.35% 24984.26 17941 39933 441702

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 613
melee 613 100.0% 21.2 14.03sec 10459 7733 7846 21113 26819 23.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.21 21.21 0.00 0.00 1.3526 0.0000 221877
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 52.75% 7845.91 505 10057 87800
crit 4.9 23.22% 21112.73 1346 26819 104012
glance 5.1 24.03% 5898.25 379 7543 30066

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.6 61.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.60 5.60 0.00 0.00 1.5292 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.6 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Disc_Smite_T11_372
devouring_plague mana 9.1% 7.4 4540
holy_fire mana 11.3% 7.7 2417
penance mana 17.6% 10.9 3923
power_infusion mana 1.3% 0.0 2521
power_word_shield mana 17.8% 4.5 6104
shadow_word_pain mana 10.5% 7.5 3973
smite mana 32.4% 4.9 3674
Resource Gains Type Count mana Average Overflow
archangel mana 12.5 83441.0 6697.3 2.8%
blessing_of_might mana 1809.6 29375.2 16.2 0.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 4.4 12252.1 2794.7 0.0%
hymn_of_hope_max_mana mana 0.9 16611.0 18742.0 0.0%
initial_mana none 1.0 117810.0 117810.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.6 92708.7 51.2 0.4%
rapture mana 23.9 218459.7 9127.2 1.6%
replenishment mana 1809.6 60877.2 33.6 0.4%
shadow_fiend mana 21.2 88812.6 4186.4 1.4%
spirit_intellect_regen mana 1809.6 120279.3 66.5 0.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 182.3sec 182.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
borrowed_time 23.9 0.0 18.9sec 18.9sec 32% 26%

Database details

  • id:59888
  • cooldown name:buff_borrowed_time
  • tooltip:$s1% spell haste until next spell cast.
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:200.00%
casting 111.3 0.0 4.1sec 4.1sec 32% 32%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 12.5 0.0 35.7sec 35.7sec 49% 83%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 15.6 57.0 29.4sec 6.1sec 89% 83%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 0.9 3.5 0.0sec 1.5sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.5sec 52.5sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_infusion 4.3 0.0 122.4sec 122.4sec 14% 16%

Database details

  • id:
  • cooldown name:buff_power_infusion
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.2sec 47.2sec 26% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 1.9 0.0 300.4sec 0.0sec 6% 6%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.1 0.1 122.5sec 111.5sec 5% 5%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 3.8 0.0 129.4sec 129.4sec 16% 16%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
weakened_soul 23.9 0.0 18.9sec 18.9sec 78% 78%

Database details

  • id:6788
  • cooldown name:buff_weakened_soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 5.6 0.0 61.1sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 17.5%
holy_evangelism_1 11.3%
holy_evangelism_2 11.4%
holy_evangelism_3 15.0%
holy_evangelism_4 10.5%
holy_evangelism_5 34.2%

Procs

Count Interval
surge_of_light 2.2 110.4sec

Statistics & Data Analysis

DPS
Population
Convergence 5.90%
σ of the average dps 52.4440
2 * σ / μ 0.9377%
95% Confidence Intervall ( μ ± 2σ ) ( 11080.52 - 11290.30 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.06% - 100.94% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 11028.08 - 11342.74 )
Sample Data
σ 5244.3959
Minimum 14685.69
Maximum 18141.90
Spread ( max - min ) 3456.21
Range ( max - min ) / 2 1728.10
Range% 15.45
10th Percentile 15844.99
90th Percentile 16957.12
( 90th Percentile - 10th Percentile ) 1112.13
Approx. Iterations needed for
1% dps error 8793
0.1% dps error 879319
0.1 scale factor error with delta=300 244477
0.05 scale factor error with delta=300 977908
0.01 scale factor error with delta=300 24447722
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 power_infusion
A archangel,if=buff.holy_evangelism.stack>=5
B power_word_shield,if=buff.weakened_soul.down
C holy_fire
D devouring_plague,if=remains<tick_time|!ticking
E shadow_word_pain,if=remains<tick_time|!ticking
F penance
G smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCDE5FGGGGGAGCGFBGGEGCDFBCFEAGGGCBDFGGEC6FBCFADEGGBGCFGGECBDFAGCGFBEGGGCDF9BCEFAGGGGGBCDFGECFBAGCDEFGBGGCGF8EDBCFAGGGGGCEBFGDCFBEAGCFGGGGBCDEF9CFBAGGGEGCDFCEFCGFCGFCGCFECFGCF6789BCDEFGGGGGACGFBGEGGCDFGBCFEAGGGBCDFGGECFBDCAFEGBGGGCFGEBDCFAGGGGBCEFGD9CFBECAFGGGBDGCFEGCABDFEGCG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6994 6191 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 123660 113160 0
Spell Power 10695 8388 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 19.50% 13.27% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 3
Soul Warding 0
Renewed Hope 1
Power Infusion 1
Atonement 2
Inner Focus 1
Rapture 3
Borrowed Time 2
Reflective Shield 0
Strength of Soul 0
Divine Aegis 3
Pain Suppression 1
Train of Thought 2
Focused Will 0
Grace 2
Power Word: Barrier 1
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 3
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 0
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 2
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Disc_Smite_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/power_infusion
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/power_word_shield,if=buff.weakened_soul.down
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/penance
actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Holy_Smite_AA_T11_372 : 8496dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
8495.5 6.43 / 0.08% 5.9 1437.6 1256.6 mana 44.75% 27.7
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGoZfuRrRkbkMdo0o
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:23459|20936|13694|12686|6784&chds=0,46918&chco=9482C9,9482C9,C0C0C0,C0C0C0,9482C9&chm=t++23459++devouring_plague,9482C9,0,0,15|t++20936++shadow_word_pain,9482C9,1,0,15|t++13694++holy_fire,C0C0C0,2,0,15|t++12686++smite,C0C0C0,3,0,15|t++6784++melee,9482C9,4,0,15&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:45,17,17,15,5,1&chds=0,100&chco=C0C0C0,9482C9,C0C0C0,9482C9,9482C9,C41F3B&chl=smite|shadow_word_pain|holy_fire|devouring_plague|melee|darkmoon_card_volcano&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:u6677764444311zyxvtqoooomllmmnnooopooooppoonlljjjijklmoqqstuwyz0122334543210yyxxwvvuuvvvvvwwwvutsrstvvvuutssrqqpponnnnnmlllllmmmmnppommllkjjihhhgffggggfeeeefffgijiihhgfdcbaZYYYYYYYYZZZZZZZaaaaZYYXXWVVUUUUTTTTTRRQQQQQPPPPQRRQQQPONNMMMLLLLLLKJIIIIIHHHHIJJJIIIHHHGGGGFEEEDDDDDDDDDDDDEFFFEEDDCCCCCCCCCCCCCCCCCBBBCCCCCCCCBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCDEHKQUYbegikkllllkkjiihhggfedcbaaZYXXXXXXYYYZZZZYYYZZZYXXVUTTSRRRRRQQQPPPQQRRSSSSSSSRRQPONNMLLLKKLLLLMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=108313&chtt=Priest_Holy_Smite_AA_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13332467665456752zvroligfebXUUUTVVWYZadefilnoopqtvvtussqonljikjfefeccbaaaaZZZZaaZZXXXWVUUTTSTTUWWYZbddeddddeeffedbbZYXVUSSSTTTTUVWXYZZZZaZZZabZYXXWWVTTSSSTVWYZZZZZZaaabbbbbaZZXWWUTSTSSTTUVWXZabccccddeefeeddcaZYXVVVVVWWWWWWXXYZZabcccbbbaaYYXWWWWVVWVWWWXXXWWWWXXXXXXWWUUTTSRRSSTTTTTTUUUUUVVVVVVVUUTSSRRQQQQQQQQPQPPPPPPPPPPPQQPPPPPPPPPPPPPPPQQRSSSTTUUUWWXZacdfghiijkkmnoppppppomljihfecbaZYXWVUUUUVVWXXYZaabaaaZZZZZYXWVUTTSSSTTUWWXYYZZabbcccbbaaZZYXWWVVUTS&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=8496|max=19656&chxp=1,1,43,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,2,3,6,7,9,10,18,17,41,51,66,83,125,148,176,185,231,281,321,362,432,484,522,543,545,590,570,541,537,463,454,447,348,317,246,200,173,134,91,76,55,32,34,10,4,7,1,1&chds=0,590&chbh=5&chxt=x&chxl=0:|min=7251|avg=8496|max=9549&chxp=0,1,54,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Holy_Smite_AA_T11_372 8496
archangel 0 0.0% 13.4 34.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.39 13.39 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 13.4 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
chakra 0 0.0% 10.8 43.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.82 10.82 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.8 100.00% 0.00 0 0 0

Action details: chakra

Static Values
  • id:14751
  • school:physical
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • description:When activated, your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite will put you into a Chakra state for $81208d. |CFFFFFFFFSerenity (Heal, Flash Heal, Greater Heal, Binding Heal)|R Increases the critical effect chance of your direct healing spells by $81208s1%, and causes your direct heals to refresh the duration of your Renew on the target. |CFFFFFFFFSanctuary (Prayer of Healing, Prayer of Mending)|R Increases the healing done by your area of effect spells and Renew by $81206s1% and reduces the cooldown of your Circle of Healing by $/1000;81206m2 sec. |CFFFFFFFFChastise (Smite, Mind Spike)|R Increases your total damage done by Shadow and Holy spells by $81209s1%.
darkmoon_card_volcano 57 0.7% 10.1 46.85sec 2545 0 2663 4116 4287 20.4% 15.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 25732
Direct Results Count Pct Average Min Max Total Damage
hit 6.5 64.00% 2662.67 2629 2775 17227
crit 2.1 20.44% 4116.01 4062 4287 8505
miss 1.6 15.56% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1283 15.1% 20.8 22.08sec 27912 23459 0 0 0 0.0% 15.6% 0.0% 0.0% 180 2857 4448 22.7% 0.0% 90.4%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.79 20.79 180.27 180.27 1.1898 2.2683 580264
Direct Results Count Pct Average Min Max Total Damage
hit 17.5 84.38% 0.00 0 0 0
miss 3.2 15.62% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 139.3 77.25% 2856.87 2297 3457 397869
crit 41.0 22.75% 4448.30 3549 5341 182395

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
holy_fire 1407 16.6% 38.6 11.87sec 16508 13694 12438 19357 24678 19.0% 15.7% 0.0% 0.0% 302 534 832 22.5% 0.0% 51.1%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.55 38.55 301.83 301.83 1.2055 0.7651 636436
Direct Results Count Pct Average Min Max Total Damage
hit 25.2 65.37% 12438.02 7733 15973 313469
crit 7.3 18.97% 19357.10 11947 24678 141535
miss 6.0 15.66% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 234.0 77.52% 534.25 334 686 125003
crit 67.9 22.48% 831.61 517 1061 56429

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 2.0 300.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 1.2132 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1485 17.5% 27.1 16.87sec 24808 20936 0 0 0 0.0% 15.6% 0.0% 0.0% 187 3187 4962 22.5% 0.0% 93.7%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.08 27.08 187.30 187.30 1.1850 2.2636 671832
Direct Results Count Pct Average Min Max Total Damage
hit 22.9 84.42% 0.00 0 0 0
miss 4.2 15.58% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 145.1 77.49% 3187.36 2587 3862 462617
crit 42.2 22.51% 4962.33 3997 5967 209214

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3813 44.9% 88.1 5.06sec 19568 12686 17370 27062 41431 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.14 88.14 0.00 0.00 1.5426 0.0000 1724805
Direct Results Count Pct Average Min Max Total Damage
hit 68.1 77.32% 17369.65 10600 26816 1183712
crit 20.0 22.68% 27062.11 16377 41431 541093

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 560
melee 560 100.0% 22.2 14.83sec 9183 6784 7327 19826 24133 21.9% 6.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.17 22.17 0.00 0.00 1.3535 0.0000 203575
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 48.04% 7327.09 505 9050 78024
crit 4.8 21.88% 19826.00 1346 24133 96154
glance 5.3 24.03% 5518.54 379 6787 29397
dodge 1.3 6.06% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 62.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.99 5.99 0.00 0.00 1.5300 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Holy_Smite_AA_T11_372
devouring_plague mana 14.8% 6.0 4632
holy_fire mana 14.9% 6.6 2506
shadow_word_pain mana 17.0% 6.1 4076
smite mana 53.3% 5.0 3935
Resource Gains Type Count mana Average Overflow
archangel mana 13.4 82200.2 6138.1 0.3%
blessing_of_might mana 1809.6 29433.3 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 5.0 12724.8 2546.2 0.0%
hymn_of_hope_max_mana mana 1.0 17244.5 17244.5 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.6 92891.4 51.3 0.2%
replenishment mana 1809.6 55231.3 30.5 0.2%
shadow_fiend mana 20.8 83078.5 3989.3 0.0%
spirit_intellect_regen mana 1809.6 179738.3 99.3 0.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 7% 11%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 127.1 0.0 3.6sec 3.6sec 39% 39%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_chastise 1.0 9.6 351.3sec 44.2sec 99% 98%

Database details

  • id:81209
  • cooldown name:buff_chakra_chastise
  • tooltip:Increases the damage done by your Shadow and Holy spells by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_pre 10.8 0.0 43.8sec 43.8sec 17% 19%

Database details

  • id:14751
  • cooldown name:buff_chakra_pre
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • max_stacks:1
  • duration:-0.00
  • cooldown:30.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 13.4 0.0 34.1sec 34.1sec 52% 52%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.2 72.0 28.5sec 5.1sec 93% 82%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 1.0 4.0 0.0sec 1.6sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.9 0.0 47.7sec 47.7sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 2.0 0.0 300.3sec 0.0sec 7% 7%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.5 0.2 119.2sec 105.5sec 6% 6%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 4.0 0.0 124.9sec 124.9sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 6.0 0.0 62.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 18.7%
holy_evangelism_1 10.9%
holy_evangelism_2 12.1%
holy_evangelism_3 13.0%
holy_evangelism_4 14.3%
holy_evangelism_5 30.9%

Procs

Count Interval
surge_of_light 2.7 105.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.58%
σ of the average dps 3.2169
2 * σ / μ 0.0757%
95% Confidence Intervall ( μ ± 2σ ) ( 8489.07 - 8501.94 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 8485.86 - 8505.16 )
Sample Data
σ 321.6898
Minimum 7251.28
Maximum 9548.69
Spread ( max - min ) 2297.41
Range ( max - min ) / 2 1148.70
Range% 13.52
10th Percentile 8087.57
90th Percentile 8917.43
( 90th Percentile - 10th Percentile ) 829.86
Approx. Iterations needed for
1% dps error 57
0.1% dps error 5735
0.1 scale factor error with delta=300 919
0.05 scale factor error with delta=300 3679
0.01 scale factor error with delta=300 91986
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 chakra
A archangel,if=buff.holy_evangelism.stack>=5
B holy_fire
C devouring_plague,if=remains<tick_time|!ticking
D shadow_word_pain,if=remains<tick_time|!ticking
E smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCDEEE5EEAEEEBEEEEEDBCBDAEE9EEEBECE6DBBAECEEDE9EBBDCAEEBEEEEDB9CBAEEDEEBECBDAEBEEE9CEDB8BDECEEBEEAEEEE9EBDECCBDDDAEBEEEECEB9DBAEECEBDDBEEABCDE9EBEDBEBDC9BEE678BCDEEEAEEEBEEEED9BCBDAEEEEEBCEDBAEBCEED9EEBBDCAEEEEBEED9BCBAEEEDEBCBDEEB9EDB8

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 1.40% 1.40% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 25.10% 19.14% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 0
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 2
Empowered Healing 3
Divine Fury 3
Desperate Prayer 1
Surge of Light 1
Inspiration 2
Divine Touch 2
Holy Concentration 2
Lightwell 1
Tome of Light 2
Rapid Renewal 1
Spirit of Redemption 1
Serendipity 2
Body and Soul 0
Chakra 1
Revelations 1
Blessed Resilience 0
Test of Faith 2
State of Mind 2
Circle of Healing 1
Guardian Spirit 1
Shadow Rank
Darkness 0
Improved Shadow Word: Pain 0
Veiled Shadows 1
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 0
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Holy_Smite_AA_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/chakra
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Shadow_T11_372 : 27113dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27113.2 9.93 / 0.04% 17.2 1572.5 1590.1 mana 0.00% 37.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
Glyphs
  • spirit_tap
  • inner_fire
  • psychic_scream
  • fading
  • fortitude
  • levitate
  • shadow_word_pain
  • shadow_word_death
  • mind_flay

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:81732|65292|35485|30176|25677|23344|21629|11606|7304&chds=0,163464&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++81732++devouring_plague,9482C9,0,0,15|t++65292++vampiric_touch,9482C9,1,0,15|t++35485++mind_blast_3,9482C9,2,0,15|t++30176++mind_blast_2,9482C9,3,0,15|t++25677++mind_blast_1,9482C9,4,0,15|t++23344++shadow_word_death,9482C9,5,0,15|t++21629++mind_blast_0,9482C9,6,0,15|t++11606++mind_flay,9482C9,7,0,15|t++7304++melee,9482C9,8,0,15&chtt=Priest_Shadow_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x330&cht=p&chf=bg,s,333333&chd=t:29,20,11,10,6,5,4,4,4,3,3,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B&chl=mind_flay|vampiric_touch|shadow_word_pain|devouring_plague|mind_blast_3|melee|mind_blast_2|shadow_word_death|shadowy_apparition|mind_blast_1|devouring_plague_burst|mind_blast_0|darkmoon_card_volcano&chtt=Priest_Shadow_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ckkkllmou5678420xwvupnmlkkkkjjihhhhhggffffffeedcbbbbbaaaaZZZYYYYYXXXXXWWVVVVUUUUVVVVVVVVVVWWWWVVVWWYacfghijjjjjjjjjiihhggggffffffeedddccccccbaaZZZYYYYXXXXXXXWWWWVVVVUUUUUUUUUUUUUUUUUUUUUTTTTUWYbcdeffggffffffffeeeddcccbbbbbbaaaaaZZZYYXXWWWWVVVVVVUUUUUUUUUTTTSSSRRRRRRRRRRRRRRRRRRRRRRSTUWYabccddddddddddddcccbbbbbbbbbaaaaaaaaaaaaaZZZZZZZZZZaaZZaaaaaaaaaZZZZZZZZZZZZZZZZZaaaaabbcegijkllllllkkkkkkkkkjjjiiiiijjjjjjjjjjjjkkkkkkkkkklllmmmmmmmmmmmmmmmmlllllll&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=168328&chtt=Priest_Shadow_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uxx222121214578655321zxwsrqrpqoomlkklkjihhihhihighgggghhhgghhhhghggfffffffffeeeeddeeffffgggghhiiijjkkkkkkkkkkkkkkjjiihhgggfffeeeeeeeeeeeefffgggghhhhhhhhhhhhhihhhggggfggfffgfffggghhhijjkklllmmmmmmmmmmlllkkjiihhgggggffffeeeddeeeeffffffggggghhhhhhhhhhhhhgggggggggfffffffffggghhhhhiiijjjkkkkkkkkkkkkkjjjiihhgggffffffffeefffffgghhiiiiijjjjjjjjjjjjjjiiiihhhhhhhhhhiiiijjkllmmnnooppqqqqqqqqqqpppoonnmmllkkkjjiiihhhhhhiiiiijjjkkkllllmmmmmmmmllllllkkjjjjjjjjiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27113|max=45674&chxp=1,1,59,100&chtt=Priest_Shadow_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,1,4,5,18,14,29,45,57,81,106,155,196,261,311,389,427,520,519,585,637,648,589,618,569,493,473,421,339,317,233,207,154,163,117,90,59,45,35,19,16,13,8,4,1,3,2,0,1&chds=0,648&chbh=5&chxt=x&chxl=0:|min=25361|avg=27113|max=29176&chxp=0,1,46,100&chtt=Priest_Shadow_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Shadow_T11_372 27113
archangel 0 0.0% 5.3 92.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.30 5.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
darkmoon_card_volcano 79 0.3% 10.2 46.27sec 3503 0 3087 4775 5217 24.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 35843
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 75.33% 3086.57 3023 3377 23790
crit 2.5 24.67% 4775.01 4671 5217 12053

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 4244 15.7% 20.2 22.85sec 94808 81732 0 0 0 0.0% 0.0% 0.0% 0.0% 203 4710 9907 22.6% 0.0% 99.0%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 203.48 203.48 1.1600 2.2009 1197605
Direct Results Count Pct Average Min Max Total Damage
hit 20.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 157.5 77.39% 4710.27 3527 7073 741701
crit 46.0 22.61% 9907.42 7371 14783 455904

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4786.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
devouring_plague_burst 798 2.9% 20.2 22.85sec 17825 0 14260 29968 44363 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 0.00 0.00 0.0000 0.0000 360860
Direct Results Count Pct Average Min Max Total Damage
hit 15.6 77.30% 14259.79 10585 21227 223154
crit 4.6 22.70% 29967.83 22122 44363 137705

Action details: devouring_plague_burst

Static Values
  • id:0
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5847.06
  • base_dd_max:5847.06
mind_blast_0 318 1.2% 5.7 72.60sec 25250 21629 20033 42376 61859 23.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_0

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.69 5.69 0.00 0.00 1.1675 0.0000 143731
Direct Results Count Pct Average Min Max Total Damage
hit 4.4 76.65% 20033.03 17287 29598 87404
crit 1.3 23.35% 42376.20 36130 61859 56326

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_1 878 3.2% 13.1 32.91sec 30255 25677 24106 50950 85225 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_1

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.13 13.13 0.00 0.00 1.1783 0.0000 397256
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 77.09% 24106.44 20772 40778 244020
crit 3.0 22.91% 50949.52 43413 85225 153236

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_2 1086 4.0% 13.8 30.27sec 35634 30176 28479 60126 108591 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_2

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.78 13.78 0.00 0.00 1.1809 0.0000 490936
Direct Results Count Pct Average Min Max Total Damage
hit 10.7 77.39% 28479.31 24256 51957 303661
crit 3.1 22.61% 60126.16 50695 108591 187275

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_3 1552 5.7% 16.8 25.53sec 41677 35485 33262 70452 131957 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_3

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.84 16.84 0.00 0.00 1.1745 0.0000 701686
Direct Results Count Pct Average Min Max Total Damage
hit 13.0 77.37% 33261.60 27740 63137 433272
crit 3.8 22.63% 70451.61 57977 131957 268414

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_flay 7825 28.9% 123.0 3.64sec 28770 11606 0 0 0 0.0% 0.0% 0.0% 0.0% 368 7347 15522 27.8% 0.0% 60.7%

Stats details: mind_flay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.01 123.01 368.05 368.05 2.4789 0.7453 3538893
Direct Results Count Pct Average Min Max Total Damage
hit 123.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 265.9 72.25% 7346.51 6348 11550 1953500
crit 102.1 27.75% 15521.85 13267 24139 1585394

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1647.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement speed slowed.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d and slowing their movement speed by $s2%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.257000
  • base_td:167.30
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 5.3 91.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.28 5.28 0.00 0.00 1.1382 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_death 1068 3.9% 17.6 6.30sec 27401 23344 21812 46133 67863 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.63 17.63 0.00 0.00 1.1738 0.0000 483020
Direct Results Count Pct Average Min Max Total Damage
hit 13.6 77.02% 21812.13 18828 32471 296137
crit 4.1 22.98% 46132.63 39351 67863 186883

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2297.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s1 Shadow damage to the target. Deals three times as much damage to targets below 25% health. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.282000
  • base_dd_min:301.52
  • base_dd_max:301.52
shadow_word_pain 4087 15.1% 1.0 398.53sec 1842885 1776163 0 0 0 0.0% 0.0% 0.0% 0.0% 202 5504 11619 22.8% 0.0% 99.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 202.18 202.18 1.0376 2.2325 1394593
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 156.1 77.21% 5503.99 4172 7893 859157
crit 46.1 22.79% 11618.97 8719 16497 535436

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowy_apparition 1003 3.7% 28.9 15.42sec 15692 0 12305 25977 33601 29.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.92 27.89 0.00 0.00 0.0000 0.0000 453821
Direct Results Count Pct Average Min Max Total Damage
hit 19.8 70.97% 12305.46 11165 16077 243541
crit 8.1 29.03% 25977.19 23334 33601 210280

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you deal periodic damage with your Shadow Word: Pain, you have a chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal shadow damage. While moving, the chance to summon the shadowy apparation is increased.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.515000
  • base_dd_min:516.19
  • base_dd_max:516.19

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch 5492 20.3% 32.4 14.09sec 76656 65292 0 0 0 0.0% 0.0% 0.0% 0.0% 200 9903 20875 22.8% 0.0% 98.3%

Stats details: vampiric_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.40 32.40 200.25 200.25 1.1741 2.2192 2483538
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.6 77.22% 9902.58 7266 14725 1531319
crit 45.6 22.78% 20874.51 15185 30776 952218

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3294.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $o2 Shadow damage over $d to your target and causes up to 10 party or raid members to gain 1% of their maximum mana per 10 sec when you deal damage from Mind Blast.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.400000
  • base_td:108.70
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - shadow_fiend 1410
melee 1410 100.0% 58.5 7.08sec 9917 7304 7469 20341 26754 22.4% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.50 58.50 0.00 0.00 1.3577 0.0000 580096
Direct Results Count Pct Average Min Max Total Damage
hit 31.3 53.56% 7469.11 505 10033 234029
crit 13.1 22.44% 20341.13 1346 26754 267004
glance 14.0 24.00% 5631.93 379 7525 79063

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 15.7 27.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.68 15.68 0.00 0.00 1.5328 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Shadow_T11_372
devouring_plague mana 13.6% 19.8 4786
mind_blast_0 mana 2.8% 7.2 3500
mind_blast_1 mana 6.5% 8.6 3500
mind_blast_2 mana 6.8% 10.2 3500
mind_blast_3 mana 8.3% 11.9 3500
mind_flay mana 28.5% 17.5 1647
shadow_word_death mana 5.7% 11.9 2297
shadow_word_pain mana 0.6% 437.6 4211
vampiric_touch mana 15.0% 23.3 3294
Resource Gains Type Count mana Average Overflow
archangel mana 5.3 186297.0 35123.2 2.9%
blessing_of_might mana 1809.6 28215.6 15.6 4.4%
dispersion mana 0.0 298.5 7596.4 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
masochism mana 17.6 154649.5 8773.1 12.9%
mp5_regen mana 1809.6 89072.3 49.2 4.3%
replenishment mana 1809.6 53466.1 29.5 4.5%
shadow_fiend mana 58.5 201292.4 3441.0 11.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.4sec 181.4sec 7% 9%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 82.0 0.0 5.5sec 5.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_archangel 5.3 0.0 92.4sec 92.4sec 21% 23%

Database details

  • id:87153
  • cooldown name:buff_dark_archangel
  • tooltip:Damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death increased by $w1%.
  • max_stacks:1
  • duration:18.00
  • cooldown:90.00
  • default_chance:100.00%
dark_evangelism 6.3 484.8 75.9sec 0.9sec 98% 96%

Database details

  • id:81661
  • cooldown name:buff_dark_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
empowered_shadow 1.0 48.4 371.1sec 9.2sec 99% 98%

Database details

  • id:95799
  • cooldown name:buff_empowered_shadow
  • tooltip:$w1% increased periodic shadow damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
glyph_of_shadow_word_death 8.9 0.0 13.2sec 13.2sec 11% 11%

Database details

  • id:
  • cooldown name:buff_glyph_of_shadow_word_death
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.9sec 51.9sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 10.0 0.0 47.0sec 47.0sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
self_movement 8.9 0.0 13.1sec 13.1sec 5% 5%

Database details

  • id:
  • cooldown name:buff_self_movement
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_orb 44.3 58.3 10.2sec 4.4sec 58% 88%

Database details

  • id:77487
  • cooldown name:buff_shadow_orb
  • tooltip:Consumed to increase damage done by Mind Blast or Mind Spike.
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend 5.3 0.0 92.1sec 0.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.2 0.0 117.3sec 117.3sec 18% 18%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.7sec 414.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 2%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 15.7 0.0 27.6sec 0.0sec 16% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_form

Database details

  • id:
  • cooldown name:buff_shadow_form
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace

Database details

  • id:
  • cooldown name:buff_vampiric_embrace
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 4.4%
dark_evangelism_1 0.0%
dark_evangelism_2 0.8%
dark_evangelism_3 0.7%
dark_evangelism_4 2.6%
dark_evangelism_5 91.5%
holy_evangelism_0 100.0%
mind_spike_0 100.0%
shadow_orb_0 11.5%
shadow_orb_1 26.6%
shadow_orb_2 27.9%
shadow_orb_3 34.1%

Procs

Count Interval
shadowy_apparation_proc 28.9 15.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.38%
σ of the average dps 4.9627
2 * σ / μ 0.0366%
95% Confidence Intervall ( μ ± 2σ ) ( 27103.26 - 27123.11 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27098.30 - 27128.08 )
Sample Data
σ 496.2700
Minimum 25360.92
Maximum 29175.99
Spread ( max - min ) 3815.06
Range ( max - min ) / 2 1907.53
Range% 7.04
10th Percentile 26514.43
90th Percentile 27779.88
( 90th Percentile - 10th Percentile ) 1265.46
Approx. Iterations needed for
1% dps error 13
0.1% dps error 1340
0.1 scale factor error with delta=300 2189
0.05 scale factor error with delta=300 8756
0.01 scale factor error with delta=300 218918
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 shadow_form
5 vampiric_embrace
6 snapshot_stats
7 volcanic_potion,if=!in_combat
8 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 mind_blast,if=buff.shadow_orb.stack>=1
A berserking
B shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains<gcd+0.5)&miss_react
C devouring_plague,if=(!ticking|dot.devouring_plague.remains<gcd+1.0)&miss_react
D stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains<cast_time+2.5
E vampiric_touch,if=(!ticking|dot.vampiric_touch.remains<cast_time+2.5)&miss_react
F start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
G archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
H shadow_word_death,health_percentage<=25
I shadow_fiend
J mind_blast
K mind_flay
L dispersion,moving=1
M devouring_plague,moving=1,if=mana_pct>10
N shadow_word_death,moving=1
O dispersion

Sample Sequence

013457ABCE9IKKGKK9KEKK9KCKK9EKKK9KKEK9CKKK9EKK9KKCE9KKKJKEKI9KCKE9GKKK9KEKC9KKK9EKK9KKCE9KKK9KEK9KCKK9EKKI9KAKEK9CKGKK9KEKK9KCKE9KKK9KEK9KCKK9EKKJKKECJKKK9IEKK9KKCEGJKKK9KEKK9CKKE9KKKJKEKCJKKK9EKKK9CKEK9KKAKJEIKKC9GKKK9EKKK9KCEK9KKFHHD9EKKK9CFHHDEK9KKFHHD9EKCK9FHHDKEK9KFHHDK9CEGIKFHHD9KKEK9FHHDKCK9EFMHHDK98KKEFHHD9KKCK9EFHHDKK9KEFHHDK9

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 23897 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 2
Evangelism 2
Archangel 1
Inner Sanctum 2
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 0
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 2
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 3
Improved Devouring Plague 2
Twisted Faith 2
Shadowform 1
Phantasm 0
Harnessed Shadows 2
Silence 0
Vampiric Embrace 1
Masochism 2
Mind Melt 2
Pain and Suffering 2
Vampiric Touch 1
Paralysis 0
Psychic Horror 0
Sin and Punishment 2
Shadowy Apparition 3
Dispersion 1

Profile

#!./simc

priest=Priest_Shadow_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
glyphs=spirit_tap/inner_fire/psychic_scream/fading/fortitude/levitate/shadow_word_pain/shadow_word_death/mind_flay
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/shadow_form
actions+=/vampiric_embrace
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mind_blast,if=buff.shadow_orb.stack>=1
actions+=/berserking
actions+=/shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains actions+=/devouring_plague,if=(!ticking|dot.devouring_plague.remains actions+=/stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains actions+=/vampiric_touch,if=(!ticking|dot.vampiric_touch.remains actions+=/start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
actions+=/archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
actions+=/shadow_word_death,health_percentage<=25
actions+=/shadow_fiend
actions+=/mind_blast
actions+=/mind_flay
actions+=/dispersion,moving=1
actions+=/devouring_plague,moving=1,if=mana_pct>10
actions+=/shadow_word_death,moving=1
actions+=/dispersion
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Rogue_Assassination_T11_372 : 27270dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27270.4 11.98 / 0.04% 1022.0 26.7 26.5 energy 42.05% 36.3
Origin http://chardev.org/?profile=36311
Talents http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
Glyphs
  • expose_armor
  • mutilate
  • backstab
  • rupture

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27508|18302|16504|14302|10470|3222|1610&chds=0,55016&chco=336600,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E&chm=t++27508++envenom,336600,0,0,15|t++18302++garrote,C55D54,1,0,15|t++16504++mutilate,C79C6E,2,0,15|t++14302++backstab,C79C6E,3,0,15|t++10470++rupture,C55D54,4,0,15|t++3222++melee_main_hand,C79C6E,5,0,15|t++1610++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Assassination_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,14,12,10,10,9,7,6,4,2,1&chds=0,100&chco=336600,336600,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54&chl=instant_poison|envenom|melee_main_hand|deadly_poison|venomous_wound|backstab|mutilate_mh|melee_off_hand|mutilate_oh|rupture|garrote&chtt=Rogue_Assassination_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:m2671uwvstvrtrtsollkjgedccbbbbXWXXYYZabccbbbbbbbbbbaZYXWWVVUUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVUUUUUUUUUUUUUUUUUUUUUUUUUUVXWVVVVWWWWXXWWWWWVVVVVUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVUUUVVVVWWWWWWVVVVUUUUUUUUUUUUUUUTTTTTTTUUUVVWWXXXYYYZZZYYYYYYXXXYabZYXXYYYYZZZaaZaZZZZZZZYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZaaaaaaaaaaaabbbbbbbcccccddddddddddddddeeedeeeeeeeeeeeeeeeeeeeffillkiiiiiiihhhiiiiiiiiiihhhhgfeddddefghiklmnopqrrrrrqpoonmlkjjihhhgggfffffffffeeeeeeeeeee&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=102&chtt=Rogue_Assassination_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:zz221233443467877421zxxuutrqponnnmmllkkkkjjiiiihggfffeedddcccbbbbbaaaaaaabbbbbbbbbcccccccccccccccccbbbbbbbbaaaaaaabbbcccddeeefffgghhhiihhhhhhhhggffffeeeedddddcccccccccccccccccddddddddddccccccccccbbbbbbaaaaaaaabbbbccccddeeeffffggggggfffgggggghhhhhiiijjjkkkkkkkkjjjjiiihhggffffeeddddccccccccccccccccccccccccddddddddeeeeeeeefffffffffffffffffffeeeeeeeeeeeffffgghiijjkkkllmmnnooopppoooooonnnmmmmlllllllllllllllmmmmmmmmmmlllkkjjjiiihhhggggggggggffffffffffffg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27270|max=49368&chxp=1,1,55,100&chtt=Rogue_Assassination_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,6,8,12,19,39,41,58,84,85,122,148,221,227,315,358,356,435,510,486,538,594,551,502,560,492,475,444,381,340,333,264,188,179,128,116,90,73,64,39,27,34,15,8,13,11,3,2,1,1&chds=0,594&chbh=5&chxt=x&chxl=0:|min=25403|avg=27270|max=29547&chxp=0,1,45,100&chtt=Rogue_Assassination_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Assassination_T11_372 27270
backstab 2473 9.1% 76.6 2.08sec 14616 14302 8263 19701 25502 59.0% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
76.55 76.55 0.00 0.00 1.0220 0.0000 1118858
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 36.10% 8263.04 7521 10724 228332
crit 45.2 59.05% 19700.64 17886 25502 890526
dodge 3.7 4.85% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
deadly_poison 2846 10.4% 346.4 1.30sec 3717 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 8022 12389 13.0% 0.0% 99.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
346.36 1.02 149.88 149.88 0.0000 3.0000 1287578
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 130.4 86.97% 8022.06 1449 10870 1045711
crit 19.5 13.03% 12389.28 2360 16794 241867

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
envenom 3936 14.4% 63.0 7.15sec 28284 27508 20413 43343 63153 38.7% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.95 62.95 0.00 0.00 1.0282 0.0000 1780541
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 56.37% 20413.23 8076 30657 724392
crit 24.4 38.71% 43343.42 16638 63153 1056149
dodge 3.1 4.92% 0.00 0 0 0

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deadly Poison application chance increased by $s3%. Instant Poison application frequency increased by $s2%.
  • description:Finishing move that consumes your Deadly Poison and deals instant poison damage. Following the Envenom attack your Deadly Poison application chance is increased by $s3%, and your Instant Poison application frequency by $s2%, for 1 sec plus an additional 1 sec per combo point. Poison doses, up to the number of combo points spent, are consumed to increase Envenom's damage: 1 point : ${$AP*0.09*$+($m1*1)} damage 2 points: Up to ${$AP*0.18*$+($m1*2)} damage 3 points: Up to ${$AP*0.27*$+($m1*3)} damage 4 points: Up to ${$AP*0.36*$+($m1*4)} damage 5 points: Up to ${$AP*0.45*$+($m1*5)} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.270000
  • base_dd_min:722.40
  • base_dd_max:722.40
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
garrote 159 0.6% 3.8 128.64sec 18980 18302 0 0 0 0.0% 4.8% 0.0% 0.0% 21 2612 5416 27.1% 0.0% 14.2%

Stats details: garrote

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.80 3.80 21.38 21.38 1.0370 3.0000 72102
Direct Results Count Pct Average Min Max Total Damage
hit 3.6 95.21% 0.00 0 0 0
dodge 0.2 4.79% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 15.6 72.89% 2612.40 2341 3587 40712
crit 5.8 27.11% 5416.36 4823 7389 31390

Action details: garrote

Static Values
  • id:703
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for $1330d and causing ${($m1+$AP*$*0.07)*6} damage over $d, increased by your attack power. Must be stealthed and behind the target. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.070000
  • base_td:132.78
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 6653 24.4% 673.0 0.70sec 4472 0 4174 6450 8655 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
673.02 673.02 0.00 0.00 0.0000 0.0000 3009536
Direct Results Count Pct Average Min Max Total Damage
hit 585.0 86.92% 4173.96 3736 5602 2441626
crit 88.1 13.08% 6449.72 5773 8655 567910

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3219 11.8% 461.5 0.98sec 3156 3222 2976 6166 8086 26.8% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
461.50 461.50 0.00 0.00 0.9794 0.0000 1456312
Direct Results Count Pct Average Min Max Total Damage
hit 149.5 32.39% 2976.48 2695 3925 444936
crit 123.8 26.82% 6166.15 5551 8086 763343
glance 110.8 24.01% 2238.01 2021 2944 248033
dodge 22.4 4.85% 0.00 0 0 0
miss 55.0 11.92% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1609 5.9% 592.5 0.76sec 1229 1610 1158 2399 3146 26.9% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
592.47 592.47 0.00 0.00 0.7631 0.0000 727886
Direct Results Count Pct Average Min Max Total Damage
hit 191.8 32.38% 1158.13 1048 1527 222148
crit 159.3 26.88% 2398.90 2160 3146 382026
glance 142.1 23.98% 870.69 786 1145 123712
dodge 28.8 4.87% 0.00 0 0 0
miss 70.5 11.90% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 2966 10.9% 79.4 3.65sec 16899 16504 0 0 0 0.0% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.39 79.39 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 75.5 95.15% 0.00 0 0 0
dodge 3.9 4.85% 0.00 0 0 0

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
mutilate_mh 1978 7.3% 75.5 3.84sec 11847 0 7181 17146 22115 46.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.54 75.54 0.00 0.00 0.0000 0.0000 894939
Direct Results Count Pct Average Min Max Total Damage
hit 40.2 53.18% 7181.01 6476 9300 288466
crit 35.4 46.82% 17146.40 15399 22115 606473

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
mutilate_oh 988 3.6% 75.5 3.84sec 5914 0 3585 8559 11034 46.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.54 75.54 0.00 0.00 0.0000 0.0000 446786
Direct Results Count Pct Average Min Max Total Damage
hit 40.2 53.16% 3584.63 3230 4640 143948
crit 35.4 46.84% 8558.65 7680 11034 302838

Action details: mutilate_oh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
rupture 674 2.5% 28.5 16.06sec 10701 10470 0 0 0 0.0% 4.8% 0.0% 0.0% 217 1093 2257 26.8% 0.0% 95.8%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 216.79 216.79 1.0220 2.0000 304721
Direct Results Count Pct Average Min Max Total Damage
hit 27.1 95.16% 0.00 0 0 0
dodge 1.4 4.84% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.6 73.18% 1093.39 572 1765 173458
crit 58.1 26.82% 2257.37 1178 3636 131263

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 1.0 114.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0049 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds
venomous_wound 2735 10.0% 142.8 3.15sec 8665 0 8088 12495 16875 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.77 142.77 0.00 0.00 0.0000 0.0000 1237069
Direct Results Count Pct Average Min Max Total Damage
hit 124.1 86.91% 8087.95 7280 10923 1003612
crit 18.7 13.09% 12495.29 11247 16875 233457

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.176000
  • base_dd_min:675.14
  • base_dd_max:675.14

Resources

Resource Usage Type Res% DPR RPE
Rogue_Assassination_T11_372
backstab energy 38.1% 243.6 60
envenom energy 18.3% 808.1 35
garrote energy 1.4% 421.8 45
mutilate energy 36.2% 307.3 55
rupture energy 5.9% 428.0 25
slice_and_dice energy 0.2% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 45.2 226.0 5.0 0.0%
cold_blood energy 4.1 102.0 24.8 0.7%
energy_refund energy 192.8 624.5 3.2 2.2%
energy_regen energy 1809.6 5366.0 3.0 0.6%
murderous_intent energy 72.8 2185.1 30.0 0.0%
overkill energy 299.6 292.6 1.0 2.9%
relentless_strikes energy 71.9 1797.6 25.0 0.0%
venomous_vim energy 142.8 1412.4 9.9 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cold_blood 4.1 0.0 124.7sec 124.7sec 0% 0%

Database details

  • id:
  • cooldown name:buff_cold_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:120.00
  • default_chance:100.00%
deadly_proc 341.3 0.0 1.3sec 1.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
envenom 54.0 9.0 8.3sec 7.1sec 73% 75%

Database details

  • id:
  • cooldown name:buff_envenom
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.5 7.1 38.9sec 23.4sec 39% 40%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.8 45.9sec 31.7sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overkill 3.8 0.0 128.6sec 128.6sec 17% 17%

Database details

  • id:
  • cooldown name:buff_overkill
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 1.0 345.3 328.4sec 1.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.7sec 78.7sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
slice_and_dice 1.0 59.9 135.4sec 7.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:21.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.1 0.7 49.9sec 45.7sec 8% 13%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 2.8 0.0 182.4sec 182.4sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
vendetta 4.3 0.0 120.3sec 120.3sec 27% 100%

Database details

  • id:
  • cooldown name:buff_vendetta
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.5%
poisoned 100.0%

Procs

Count Interval
combo_points 379.7 2.2sec
combo_points_wasted 17.5 24.5sec
deadly_poisons 346.4 1.3sec
ruthlessness 52.8 8.6sec
seal_fate 99.4 4.5sec
venomous_wounds 142.8 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 69.67%
σ of the average dps 5.9918
2 * σ / μ 0.0439%
95% Confidence Intervall ( μ ± 2σ ) ( 27258.37 - 27282.34 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27252.38 - 27288.33 )
Sample Data
σ 599.1798
Minimum 25402.87
Maximum 29547.15
Spread ( max - min ) 4144.28
Range ( max - min ) / 2 2072.14
Range% 7.60
10th Percentile 26536.87
90th Percentile 28051.28
( 90th Percentile - 10th Percentile ) 1514.41
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1931
0.1 scale factor error with delta=300 3191
0.05 scale factor error with delta=300 12765
0.01 scale factor error with delta=300 319125
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 garrote
A slice_and_dice,if=buff.slice_and_dice.down
B rupture,if=!ticking&time<6
C vendetta
D rupture,if=!ticking&buff.slice_and_dice.remains>6
E cold_blood,sync=envenom
F envenom,if=combo_points>=4&buff.envenom.down
G envenom,if=combo_points>=4&energy>90
H envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
I backstab,if=combo_points<5&target.health_pct<35
J mutilate,if=combo_points<4&target.health_pct>=35
K vanish,if=time>30&energy>50

Sample Sequence

01245689ABBCJEFJGJJFJDJFJJFJJDK9JFJFJGJGJJDJJJFJJFJJDJFJJFJDJFJJFJDJFJFJFDCJEFJFDJJFJDJFJJFJDJFJJ8DJJFJJFJDJFJFJJDJFK9JFJJFJDJJFCJFJJDJJEFJFJJJDJJFJJFJDJJFJDJJFJJFJDJFJJFJDIIFII8FGGCIDIIIIFIIIIFIIDDIIIEFIIFIIIDIIFIIK9FIIGIIGIIIDIIFIIIFIIIFIIDIIIFIIIFIIIFDIIFIIIDIIIFIIFICIIIFIDIIFIIIFDIIEFIIIIF4IDIIIFIIIDIIIFII8IIFI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 13.01% 13.01% 1333
Spell Crit 9.88% 4.88% 874
Spell Haste 16.59% 11.03% 1413
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 15656 11048 190
Melee Hit 11.10% 11.10% 1333
Melee Crit 29.90% 20.89% 874
Melee Haste 11.03% 11.03% 1413
Expertise 6.56 6.56 197
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.76% 17.76% 1749

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 3
Lethality 3
Ruthlessness 3
Quickening 2
Puncturing Wounds 3
Blackjack 0
Deadly Brew 1
Cold Blood 1
Vile Poisons 3
Deadened Nerves 0
Seal Fate 2
Murderous Intent 2
Overkill 1
Master Poisoner 1
Improved Expose Armor 0
Cut to the Chase 3
Venomous Wounds 2
Vendetta 1
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 2
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 3
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Assassination_T11_372
origin="http://chardev.org/?profile=36311"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
glyphs=expose_armor/mutilate/backstab/rupture
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/garrote
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/rupture,if=!ticking&time<6
actions+=/vendetta
actions+=/rupture,if=!ticking&buff.slice_and_dice.remains>6
actions+=/cold_blood,sync=envenom
actions+=/envenom,if=combo_points>=4&buff.envenom.down
actions+=/envenom,if=combo_points>=4&energy>90
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/backstab,if=combo_points<5&target.health_pct<35
actions+=/mutilate,if=combo_points<4&target.health_pct>=35
actions+=/vanish,if=time>30&energy>50
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=197
# gear_hit_rating=1333
# gear_crit_rating=874
# gear_haste_rating=1413
# gear_mastery_rating=1749
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Combat_T11_372 : 26791dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26790.9 11.32 / 0.04% 1009.2 26.5 26.4 energy 24.68% 45.7
Origin http://chardev.org/?profile=55921
Talents http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
Glyphs
  • expose_armor
  • slice_and_dice
  • sinister_strike
  • adrenaline_rush

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:56140|30125|23128|10570|8089|4555|3976&chds=0,112280&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++56140++killing_spree,C79C6E,0,0,15|t++30125++eviscerate,C79C6E,1,0,15|t++23128++rupture,C55D54,2,0,15|t++10570++sinister_strike,C79C6E,3,0,15|t++8089++revealing_strike,C79C6E,4,0,15|t++4555++melee_main_hand,C79C6E,5,0,15|t++3976++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Combat_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:19,17,15,14,9,8,8,4,3,2,1&chds=0,100&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,336600,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|melee_main_hand|melee_off_hand|instant_poison|main_gauche|deadly_poison|eviscerate|rupture|revealing_strike|killing_spree_mh|killing_spree_oh&chtt=Rogue_Combat_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o72wrou0yvqoomkjjjkkllqrppruy012467655663yspolhfcaXVVUTTSTTTSSSTTTTTUUUUUUTTTTUUUTUUTTTTTTTTTSSSSSSSSSTTTUVVWXYZacdefgiijjjkkkkjjiihffecbaZYXXWVVUTTTSSSSSSSSSSSSTSTTTTTTTTTTTSSSSSSSTUUUUUVVWWVVWWXYYZabcdeffghijjkkkkkjjihgfedbaZYXWVVUUUTTTTTTTTTTTUUUUUUUUUUUUTTTTTTTTSSSSSSSSSTTTTUUUVVWXYYZabcdefgghhiiiiiihhggffeedccbbaZZYXXWWVVVUUUTTTTTSSSSSSSSSSSSSSSSSSSSSSSSTUUVVWXXYZZZZZaabcddefgghiijkklllmmlkkjihgfdcbaZYXWWVVUUTTTTTSSSSSSSSTSSSSTTSSSSSSSSSSSSSST&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Rogue_Combat_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suvxyz01234566666787654210zyxwvuuuuuuutssrrrrqqponmlkjjihggggffffffffgggghhiiijjjjjjkkkkjjjjiiihhgggffffffggghijklmnoppqrsssttsssrrqpponmllkjiihhgggggggggghhhiiiiiiiiiihhhhhgggggggggghhhijjklmmnnoopppppqqqqqqqpppppooonnnmmmmmllllkkkkjjjjiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiijjkkllmnnooppqqqrrrrqqqqppoonnmmllkkjjjiiiiiiiiiiihhhhhhhhgggggfffffffggghhhiijjkklmmnnooppqqqqqrrrrrrrrrrrrqqqqqppppooonnnmmllkkjjiiihhhggggfffffffffggggggggghhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26791|max=42307&chxp=1,1,63,100&chtt=Rogue_Combat_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,3,1,4,4,7,25,37,40,61,104,126,173,238,279,358,436,466,577,544,647,650,657,668,619,576,502,432,361,317,291,179,167,112,98,77,51,40,20,18,16,5,3,5,2,0,3&chds=0,668&chbh=5&chxt=x&chxl=0:|min=24464|avg=26791|max=29079&chxp=0,1,50,100&chtt=Rogue_Combat_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Combat_T11_372 26791
deadly_poison 2159 8.1% 187.6 2.40sec 5206 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148 6135 9479 13.4% 0.0% 98.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
187.61 2.81 148.33 148.33 0.0000 3.0000 976661
Direct Results Count Pct Average Min Max Total Damage
hit 2.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.4 86.58% 6135.31 989 9733 787920
crit 19.9 13.42% 9479.47 1528 15038 188741

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2125 7.9% 31.3 14.32sec 30698 30125 21286 43758 58658 41.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.32 31.32 0.00 0.00 1.0190 0.0000 961467
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 58.11% 21286.31 13135 28475 387438
crit 13.1 41.89% 43757.51 27058 58658 574029

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 3721 13.9% 484.6 0.99sec 3473 0 3249 5020 7747 13.4% 0.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.65 484.65 0.00 0.00 0.0000 0.0000 1683059
Direct Results Count Pct Average Min Max Total Damage
hit 417.8 86.22% 3248.55 2549 5014 1357381
crit 64.9 13.39% 5019.52 3938 7747 325677
miss 1.9 0.40% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
killing_spree 912 3.4% 7.3 63.46sec 56535 56140 0 0 0 0.0% 0.0% 0.0% 0.0% 36 0 0 0.0% 0.0% 4.0%

Stats details: killing_spree

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.30 7.30 36.37 0.00 1.0070 0.5000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:energy
  • tree:combat
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 577 2.2% 36.4 11.34sec 7172 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 5547 11472 27.4% 0.0% 0.0%

Stats details: killing_spree_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.37 0.00 0.00 36.37 0.0000 0.0000 260838
Tick Results Count Pct Average Min Max Total Damage
hit 26.4 72.57% 5546.81 3854 7367 146388
crit 10.0 27.43% 11472.29 7938 15176 114450

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 335 1.3% 36.4 11.34sec 4171 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3228 6687 27.3% 0.0% 0.0%

Stats details: killing_spree_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.37 0.00 0.00 36.37 0.0000 0.0000 151703
Tick Results Count Pct Average Min Max Total Damage
hit 26.4 72.73% 3228.04 2235 4327 85381
crit 9.9 27.27% 6687.23 4604 8913 66322

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 2470 9.2% 178.2 2.53sec 6271 0 4864 10040 15176 27.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.19 178.19 0.00 0.00 0.0000 0.0000 1117404
Direct Results Count Pct Average Min Max Total Damage
hit 129.8 72.82% 4864.33 3854 7367 631194
crit 48.4 27.18% 10039.69 7938 15176 486210

Action details: main_gauche

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 4550 17.0% 360.9 1.26sec 5703 4555 5134 10607 16163 27.2% 11.9% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
360.91 360.91 0.00 0.00 1.2521 0.0000 2058398
Direct Results Count Pct Average Min Max Total Damage
hit 132.8 36.78% 5133.53 4088 7846 681478
crit 98.3 27.23% 10606.95 8422 16163 1042346
glance 86.8 24.05% 3854.42 3066 5885 334574
miss 43.1 11.94% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3975 14.8% 669.0 0.68sec 2687 3976 2419 4999 7617 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
669.03 669.03 0.00 0.00 0.6759 0.0000 1798005
Direct Results Count Pct Average Min Max Total Damage
hit 246.4 36.83% 2419.38 1927 3697 596145
crit 182.1 27.22% 4999.09 3969 7617 910298
glance 160.5 23.99% 1816.82 1445 2773 291562
miss 80.1 11.97% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revealing_strike 684 2.6% 37.5 11.97sec 8257 8089 6394 13206 16836 27.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: revealing_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.49 37.49 0.00 0.00 1.0207 0.0000 309559
Direct Results Count Pct Average Min Max Total Damage
hit 27.2 72.64% 6393.53 5110 8173 174122
crit 10.3 27.36% 13205.66 10527 16836 135437

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reveals a weakness, increasing the effectiveness of the rogue's next finishing move by $s3%.
  • description:An instant strike that causes $m1% of your normal weapon damage and increases the effectiveness of your next offensive finishing move on that target by $s3% for $d. Awards 1 combo point.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 998 3.7% 19.1 23.35sec 23582 23128 0 0 0 0.0% 0.0% 0.0% 0.0% 153 2294 4740 27.1% 0.0% 67.5%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.14 19.14 152.62 152.62 1.0196 2.0000 451385
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 111.2 72.86% 2293.78 1464 3178 255070
crit 41.4 27.14% 4740.19 3015 6546 196316

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
sinister_strike 5196 19.4% 218.7 2.07sec 10747 10570 7434 17709 22617 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
218.73 218.73 0.00 0.00 1.0167 0.0000 2350628
Direct Results Count Pct Average Min Max Total Damage
hit 148.2 67.76% 7434.34 6012 9511 1101870
crit 70.5 32.24% 17708.86 14296 22617 1248758

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:39.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:200.29
  • base_dd_max:200.29
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slice_and_dice 0 0.0% 16.2 28.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.17 16.17 0.00 0.00 1.0187 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.2 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Combat_T11_372
eviscerate energy 9.1% 877.1 35
revealing_strike energy 12.5% 206.4 40
rupture energy 4.0% 943.3 25
sinister_strike energy 71.0% 275.6 39
slice_and_dice energy 3.4% 0.0 25
Resource Gains Type Count energy Average Overflow
adrenaline_rush energy 417.0 1454.8 3.5 6.9%
combat_potency energy 153.5 2239.2 14.6 2.8%
energy_regen energy 1809.6 6767.3 3.7 1.5%
relentless_strikes energy 59.2 1480.6 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.3 0.0 88.4sec 88.4sec 23% 34%

Database details

  • id:
  • cooldown name:buff_adrenaline_rush
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
berserking 3.0 0.0 180.4sec 180.4sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 173.1 0.0 2.6sec 2.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
killing_spree 7.3 0.0 63.5sec 63.5sec 3% 39%

Database details

  • id:
  • cooldown name:buff_killing_spree
  • tooltip:(null)
  • max_stacks:1
  • duration:2.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 13.4 13.7 33.7sec 16.2sec 51% 53%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.6 4.1 45.3sec 30.9sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
poison_doses 2.8 184.0 143.5sec 2.4sec 99% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.4sec 78.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
revealing_strike 37.5 0.0 12.0sec 12.0sec 14% 85%

Database details

  • id:
  • cooldown name:buff_revealing_strike
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
slice_and_dice 1.3 14.8 221.5sec 28.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:22.50
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 7.8 1.2 52.7sec 44.6sec 14% 20%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
deep_insight 41.2%
energy_cap 1.9%
moderate_insight 20.1%
shallow_insight 20.5%

Procs

Count Interval
combo_points 300.0 1.8sec
combo_points_wasted 1.3 115.3sec
deadly_poisons 187.6 2.4sec
main_gauche 178.2 2.5sec
sinister_strike_glyph 43.7 10.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.16%
σ of the average dps 5.6579
2 * σ / μ 0.0422%
95% Confidence Intervall ( μ ± 2σ ) ( 26779.54 - 26802.18 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26773.89 - 26807.83 )
Sample Data
σ 565.7887
Minimum 24464.16
Maximum 29078.78
Spread ( max - min ) 4614.62
Range ( max - min ) / 2 2307.31
Range% 8.61
10th Percentile 26097.13
90th Percentile 27540.74
( 90th Percentile - 10th Percentile ) 1443.62
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1784
0.1 scale factor error with delta=300 2845
0.05 scale factor error with delta=300 11381
0.01 scale factor error with delta=300 284548
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 kick
7 berserking
8 slice_and_dice,if=buff.slice_and_dice.down
9 slice_and_dice,if=buff.slice_and_dice.remains<2
A killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
B adrenaline_rush,if=energy<35
C eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
D rupture,if=!ticking&combo_points=5&target.time_to_die>10
E eviscerate,if=combo_points=5
F revealing_strike,if=combo_points=4&buff.revealing_strike.down
G sinister_strike,if=combo_points<5

Sample Sequence

012457G8GGGFDGGGGEGGGGCGGGFCG9GGAGGFDGGBGFEGGGGF9GGGGGCGGGFDGGGEGGGGFEGGGFDGG9GAGGGCGGFDGGGFEGGG9GGGGFDGGBFCGGGCGGGGFCG9GGGFDGGGAGFEGGGF9GGGDGGGGGEG7GFDGGGGEGGGFDG9GGGGBCGGGGEGGGGFDGG9GGGFCGGGACGGGGFDGGGEGG9GGGGDGGGGFCGG9GGGGFDGBGGGEGGFEGGGF9GGGGCGGGCGAGGFDGGGFEGGGGFCGG9GGGGFDG7GGEGGFEGB8GGFCGGGFCGGGFCGGGFDGGGFEG9AGGGFDGGGGG9GGGGDGGGFEGGGGFDGGG9GBGGGFCGGFDGGGFEGGGFEGGFADGGGG9GGGGFDGGGG4FEGGGFDG9GGFCGG7GF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 10.60% 10.60% 1086
Spell Crit 10.24% 5.24% 940
Spell Haste 18.83% 13.17% 1687
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20352 14362 190
Melee Hit 9.04% 9.04% 1086
Melee Crit 30.27% 21.26% 940
Melee Haste 13.17% 13.17% 1687
Expertise 26.01 26.01 781
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1057

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 2
Puncturing Wounds 0
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 2
Improved Sinister Strike 3
Precision 3
Improved Slice and Dice 2
Improved Sprint 2
Aggression 3
Improved Kick 0
Lightning Reflexes 3
Revealing Strike 1
Reinforced Leather 0
Improved Gouge 0
Combat Potency 3
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 1
Savage Combat 2
Bandit's Guile 3
Restless Blades 2
Killing Spree 1
Subtlety Rank
Nightstalker 0
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 0
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Combat_T11_372
origin="http://chardev.org/?profile=55921"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
glyphs=expose_armor/slice_and_dice/sinister_strike/adrenaline_rush
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/kick
actions+=/berserking
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
actions+=/rupture,if=!ticking&combo_points=5&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5
actions+=/revealing_strike,if=combo_points=4&buff.revealing_strike.down
actions+=/sinister_strike,if=combo_points<5
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=1086
# gear_crit_rating=940
# gear_haste_rating=1687
# gear_mastery_rating=1057
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Subtlety_T11_372 : 26681dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26680.9 9.40 / 0.04% 1201.9 22.2 22.1 energy 34.46% 46.2
Origin http://chardev.org/?profile=36352
Talents http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
Glyphs
  • expose_armor
  • backstab
  • shadow_dance
  • slice_and_dice

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:115926|34075|26081|25225|4692|2346&chds=0,231853&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++115926++rupture,C55D54,0,0,15|t++34075++ambush,C79C6E,1,0,15|t++26081++eviscerate,C79C6E,2,0,15|t++25225++backstab,C79C6E,3,0,15|t++4692++melee_main_hand,C79C6E,4,0,15|t++2346++melee_off_hand,C79C6E,5,0,15&chtt=Rogue_Subtlety_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:31,18,11,11,9,8,7,5&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,C55D54&chl=backstab|melee_main_hand|ambush|eviscerate|melee_off_hand|instant_poison|deadly_poison|rupture&chtt=Rogue_Subtlety_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:k70mtmYdWUVcifnoroeiadbfbgrtqzzrlekhgfhptjYdZYZXbfeXdXbmkbcfXefmuuqjcZZSSWbXdaahkfcgagedccfgfZdacggbbeZdacaeehdadadeeZdcbdccbhjrusngZWTSVWZZbbcfdebcbdcdcacbccebefeeddcgegeeffedebededfffgehinqsqnhcZWVWYYaabccdcececdddddededdddddedecdcdccccdcedfeffeeefgjloppmieaXWXXZZbcdddeddddcccbcbcbccdccccdcdcdcddddcdcdccccccdeghknoonkgdaZYYYabcdddddcdcdccdcdcdcdcdccccdcdcdcdeeffffgghhggghijlmmljgdaYXXXYZbccddeeeeeeeeeeeeeeeeeedddddcdccccccdcdcdcddcddfgjkmmmkhebZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=86&chtt=Rogue_Subtlety_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:85653445543231zzwvvuutttstrqooooooqpqqqqqonmkkjjiiiigffdeeffffggghiihiiiiijjkjihhhhgggffffffeffeeddddccbcccccccdddccbbccdeffggggghhhhhhijjjjjihggffffeeeddddccccccccccccdddeeeefefffefffgghhiiiiiiiiiiijjjjjihhggfffffffffffffffffgggggggfffffeeeeeddeeffghhhiiiiiiiijjjjjjihggffeedddcccccccccbbbbbbbcccccccccccccccdeffghhhiiijjjkkllllkkjiihggfffeedddcccccccccddddeeefffggghhhhiijjjkkkkkklllllllllkkkjjiiiiiiiiiiiiiiiiiiiiiiihhhgggfffeeddddddeeffgghhhhhiijkk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26681|max=47466&chxp=1,1,56,100&chtt=Rogue_Subtlety_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,4,8,9,13,22,48,50,70,91,137,163,211,274,309,395,429,481,514,598,589,567,565,540,536,509,458,437,388,290,264,246,201,161,105,86,68,57,42,26,10,13,3,7,2,0,0,0,1&chds=0,598&chbh=5&chxt=x&chxl=0:|min=25090|avg=26681|max=28565&chxp=0,1,46,100&chtt=Rogue_Subtlety_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Subtlety_T11_372 26681
ambush 3012 11.3% 39.1 11.36sec 34812 34075 16733 35617 57105 95.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.14 39.14 0.00 0.00 1.0216 0.0000 1362568
Direct Results Count Pct Average Min Max Total Damage
hit 1.6 4.17% 16732.68 13047 24967 27298
crit 37.5 95.78% 35617.17 26877 57105 1335270
dodge 0.0 0.05% 0.00 0 0 0

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target (${$m2*1.447}% plus ${$m1*$m2/100*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:367.95
  • base_dd_max:367.95
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
backstab 8201 30.7% 143.0 3.08sec 25952 25225 13171 31421 46055 70.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.96 142.96 0.00 0.00 1.0288 0.0000 3710015
Direct Results Count Pct Average Min Max Total Damage
hit 42.7 29.87% 13171.08 11839 19367 562434
crit 100.2 70.07% 31421.07 28152 46055 3147580
dodge 0.1 0.06% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
deadly_poison 1929 7.2% 167.1 2.70sec 5225 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147 5488 8483 14.7% 0.0% 97.6%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.06 3.83 147.25 147.25 0.0000 3.0000 872857
Direct Results Count Pct Average Min Max Total Damage
hit 3.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.6 85.31% 5487.93 1079 7345 689372
crit 21.6 14.69% 8482.96 1667 11348 183486

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2944 11.0% 49.8 8.92sec 26760 26081 18037 37145 52612 45.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
49.78 49.78 0.00 0.00 1.0260 0.0000 1332044
Direct Results Count Pct Average Min Max Total Damage
hit 27.0 54.24% 18036.52 15278 25540 486986
crit 22.8 45.70% 37145.07 31472 52612 845058
dodge 0.0 0.05% 0.00 0 0 0

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 2125 8.0% 314.8 1.43sec 3054 0 2934 4534 5846 14.1% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
314.80 314.80 0.00 0.00 0.0000 0.0000 961323
Direct Results Count Pct Average Min Max Total Damage
hit 259.0 82.28% 2934.37 2781 3784 760024
crit 44.4 14.10% 4534.24 4296 5846 201299
miss 11.4 3.62% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4689 17.6% 510.3 0.89sec 4157 4692 3554 7383 10605 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
510.30 510.30 0.00 0.00 0.8859 0.0000 2121123
Direct Results Count Pct Average Min Max Total Damage
hit 131.5 25.76% 3554.20 3091 5148 467217
crit 179.6 35.20% 7382.58 6368 10605 1326215
glance 122.3 23.97% 2678.84 2319 3861 327691
dodge 0.3 0.06% 0.00 0 0 0
miss 76.6 15.01% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2344 8.8% 655.6 0.69sec 1618 2346 1383 2872 4125 35.2% 15.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
655.62 655.62 0.00 0.00 0.6897 0.0000 1060567
Direct Results Count Pct Average Min Max Total Damage
hit 168.6 25.72% 1382.70 1203 2003 233151
crit 231.0 35.23% 2871.86 2477 4125 663380
glance 157.4 24.01% 1042.03 902 1502 164037
dodge 0.4 0.06% 0.00 0 0 0
miss 98.2 14.98% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recuperate 0 0.0% 14.9 30.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recuperate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.88 14.88 0.00 0.00 1.0190 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: recuperate

Static Values
  • id:73651
  • school:physical
  • resource:energy
  • tree:combat
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Recovering $w1% of maximum health every $t1 sec.
  • description:Finishing move that consumes combo points on any nearby target to restore $s1% of maximum health every $t1 sec. Lasts longer per combo point: 1 point : 6 seconds 2 points: 12 seconds 3 points: 18 seconds 4 points: 24 seconds 5 points: 30 seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rupture 1437 5.4% 5.5 87.24sec 118021 115926 0 0 0 0.0% 0.1% 0.0% 0.0% 220 2155 4452 35.1% 0.0% 97.1%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.51 5.51 219.59 219.59 1.0181 2.0000 650073
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 99.93% 0.00 0 0 0
dodge 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 142.6 64.93% 2155.01 2058 2750 307267
crit 77.0 35.07% 4451.66 4238 5665 342806

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 17.3 26.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.32 17.32 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 17.3 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Subtlety_T11_372
ambush energy 15.6% 870.3 40
backstab energy 56.9% 648.8 40
eviscerate energy 17.3% 764.6 35
recuperate energy 4.4% 0.0 30
rupture energy 1.4% 4720.9 25
slice_and_dice energy 4.3% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 100.2 500.9 5.0 0.0%
energy_refund energy 175.6 4.0 0.0 0.0%
energy_regen energy 1809.6 5574.0 3.1 0.0%
recuperate energy 143.3 1718.6 12.0 0.0%
relentless_strikes energy 87.4 2186.2 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 142.5 0.0 3.1sec 3.1sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
find_weakness 11.7 27.4 40.0sec 11.4sec 37% 100%

Database details

  • id:
  • cooldown name:buff_find_weakness
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.0 8.1 37.3sec 21.6sec 41% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.7 46.7sec 32.6sec 29% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.6 0.0 83.3sec 83.3sec 7% 100%

Database details

  • id:
  • cooldown name:buff_master_of_subtlety
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 3.8 157.2 112.0sec 2.8sec 98% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.8sec 78.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
recuperate 6.7 8.2 69.9sec 31.0sec 95% 95%

Database details

  • id:
  • cooldown name:buff_recuperate
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_dance 7.6 0.0 63.2sec 63.2sec 13% 13%

Database details

  • id:
  • cooldown name:buff_shadow_dance
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
shadowstep 7.6 0.0 63.6sec 63.6sec 0% 100%

Database details

  • id:
  • cooldown name:buff_shadowstep
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 8.5 8.8 53.6sec 26.8sec 97% 99%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.8 1.1 47.0sec 41.4sec 11% 17%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 4.6 0.0 98.6sec 98.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points 486.3 1.2sec
combo_points_wasted 46.5 13.7sec
deadly_poisons 167.1 2.7sec
hat_donor 303.4 1.5sec
honor_among_thieves 205.3 2.2sec
serrated_blades 49.8 8.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.97%
σ of the average dps 4.6989
2 * σ / μ 0.0352%
95% Confidence Intervall ( μ ± 2σ ) ( 26671.49 - 26690.28 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26666.79 - 26694.98 )
Sample Data
σ 469.8913
Minimum 25089.71
Maximum 28565.16
Spread ( max - min ) 3475.45
Range ( max - min ) / 2 1737.72
Range% 6.51
10th Percentile 26108.05
90th Percentile 27324.80
( 90th Percentile - 10th Percentile ) 1216.74
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1240
0.1 scale factor error with delta=300 1962
0.05 scale factor error with delta=300 7850
0.01 scale factor error with delta=300 196264
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 pool_energy,for_next=1
A shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
B pool_energy,for_next=1
C vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
D shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
E premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
F ambush,if=combo_points<=4
G preparation,if=cooldown.vanish.remains>60
H slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
I rupture,if=combo_points=5&!ticking
J recuperate,if=combo_points=5&remains<3
K eviscerate,if=combo_points=5&dot.rupture.remains>1
L backstab,if=combo_points<3&energy>60
M backstab,if=cooldown.honor_among_thieves.remains>1.75
N backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0

Sample Sequence

0124568DEFHAFFIFFJFFKLNKLLMKLLHCEFGKLLMJLLMKBBCFKMMKLMMHLMK9999ADEFJFFKFKLMMHLMKLLKLMMJLMKLMMHMMKLMKLMMJ9999999ADEFKFFHFFKMMKMMKLLJLMMHMMILMMKMMK8LMMJMM99H999ADEFIFFKFFKLMKMMJLLHCEFKLMKLLKLMMKMMHLLJL99999ADFIEFKFFKMMKLLHLLMJLMILMMKLLHLMMKMMJLLMK999999ADEFKFFHFKLLKLMMJMMKLLHLLMK8MMKLMMJMMKBCEFGHL9999ADFKFFKFKMMKLLHLMMJBBBLMICEFKLMKLLHLLMKLMJ9999ADEFKFFKFKMMHLMMKLMJLMKLMMKLMHLLKLLMJMM9K999ADEFKFFH4FKLLKLMMJMMKMM8HLM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 8637 6944 4879
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.38% 9.38% 961
Spell Crit 11.43% 6.43% 1152
Spell Haste 20.59% 14.84% 1901
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20143 14341 190
Melee Hit 8.00% 8.00% 961
Melee Crit 37.73% 27.51% 1152
Melee Haste 14.84% 14.84% 1901
Expertise 25.78 25.78 774
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 29.69% 23.83% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.50% 11.50% 628

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 0
Puncturing Wounds 3
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 0
Improved Ambush 3
Relentless Strikes 3
Elusiveness 1
Waylay 0
Opportunity 3
Initiative 2
Energetic Recovery 3
Find Weakness 2
Hemorrhage 1
Honor Among Thieves 3
Premeditation 1
Enveloping Shadows 0
Cheat Death 0
Preparation 1
Sanguinary Vein 2
Slaughter from the Shadows 3
Serrated Blades 2
Shadow Dance 1

Profile

#!./simc

rogue=Rogue_Subtlety_T11_372
origin="http://chardev.org/?profile=36352"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
glyphs=expose_armor/backstab/shadow_dance/slice_and_dice
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/pool_energy,for_next=1
actions+=/shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
actions+=/pool_energy,for_next=1
actions+=/vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
actions+=/shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=4
actions+=/preparation,if=cooldown.vanish.remains>60
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&!ticking
actions+=/recuperate,if=combo_points=5&remains<3
actions+=/eviscerate,if=combo_points=5&dot.rupture.remains>1
actions+=/backstab,if=combo_points<3&energy>60
actions+=/backstab,if=cooldown.honor_among_thieves.remains>1.75
actions+=/backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4879
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=774
# gear_hit_rating=961
# gear_crit_rating=1152
# gear_haste_rating=1901
# gear_mastery_rating=628
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# These values represent the avg HAT donor interval of the raid. # A negative value will make the Rogue use a programmed default interval. # A zero value will disable virtual HAT procs and assume a real raid is being simulated. virtual_hat_interval=-1 # A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Shaman_Elemental_T11_372 : 26680dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26679.9 11.77 / 0.04% 22.0 1211.7 1225.5 mana 0.00% 47.0
Origin http://chardev.org/?profile=14385
Talents http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
Glyphs
  • chain_lightning
  • thunder
  • healing_stream_totem
  • thunderstorm
  • astral_recall
  • renewed_life
  • flame_shock
  • lightning_bolt
  • lava_burst

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:39855|31165|13592|7501|5098|3566|625|126&chds=0,79709&chco=C41F3B,C41F3B,336600,336600,C41F3B,C41F3B,C79C6E,C41F3B&chm=t++39855++flame_shock,C41F3B,0,0,15|t++31165++lava_burst,C41F3B,1,0,15|t++13592++lightning_bolt,336600,2,0,15|t++7501++earth_shock,336600,3,0,15|t++5098++fire_nova,C41F3B,4,0,15|t++3566++fire_melee,C41F3B,5,0,15|t++625++earth_melee,C79C6E,6,0,15|t++126++fire_shield,C41F3B,7,0,15&chtt=Shaman_Elemental_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x340&cht=p&chf=bg,s,333333&chd=t:35,19,10,9,7,7,6,2,2,1,1,0,0,0&chds=0,100&chco=336600,C41F3B,336600,336600,C41F3B,C41F3B,C41F3B,336600,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C41F3B&chl=lightning_bolt|lava_burst|lightning_bolt_overload|fulmination|flame_shock|searing_totem|lava_burst_overload|earth_shock|fire_melee|fire_nova|earth_melee|fire_blast|darkmoon_card_volcano|fire_shield&chtt=Shaman_Elemental_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:q32zyyyyz01223344556545544444444444445555555555555555566667777666666655555555554444555555555555556666677777776666666655555555554444444444555555566667777877777766666555555555555555554444444445555666677777776666655555555555555555555555555556666666666666666666665555555555555555555555555556666666666666666666665555555555555555555555556666666666666666666666666655555555544444445555555666666777766666666555555555555555555555555555555555555666666666655555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117081&chtt=Shaman_Elemental_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwy0122222464577765421zywuutssrqqqppqpqponmnmmnnnmmmlmllmlmmmnnoonononnnopooqppponnonnonoonnnnmmmmmmllmmlmmmmlkkkkkkjiihhhhgggfffffffgghijklmnoppqqrrrrssrrrqpponmmlkkjjjiihhgggfggghhhiiiiijjjkkkkkllkkkjjiiiihhhiiiiijjkklmmnnooooooooooonmmlllkkkkkjjjjiihhhhhhhhggggggfffggggghhhhhhhiiijjkkllmmmnnnnnnnnnnnmmllkkjiihhhhhhhghhhhhiiiiijjjjjjjjjjjjjjiiiiiiiiiiihhhiijjjkkllmnooppqqrrrrrrqqqpoonmllkjjiihhhggggggggggggggfffffffffgggghhhhhiiijjkkkllllllllmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26680|max=42382&chxp=1,1,63,100&chtt=Shaman_Elemental_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,3,5,10,21,28,36,62,86,127,155,225,291,314,380,445,498,575,595,599,660,661,605,586,519,456,397,318,286,253,190,156,116,88,70,53,36,31,20,15,8,11,5,1,0,0,0,0,1&chds=0,661&chbh=5&chxt=x&chxl=0:|min=24670|avg=26680|max=29297&chxp=0,1,43,100&chtt=Shaman_Elemental_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Elemental_T11_372 26680
darkmoon_card_volcano 70 0.3% 10.1 47.05sec 3134 0 2724 4210 4516 27.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.07 10.07 0.00 0.00 0.0000 0.0000 31565
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.38% 2723.60 2694 2923 19854
crit 2.8 27.62% 4210.34 4162 4516 11711

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
earth_shock 598 2.2% 30.5 14.57sec 8880 7501 6930 14566 20686 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.47 30.47 0.00 0.00 1.1839 0.0000 270531
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.47% 6930.28 5948 9898 157230
crit 7.8 25.53% 14566.43 12432 20686 113301

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
elemental_mastery 0 0.0% 6.6 74.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_mastery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.63 6.63 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.6 100.00% 0.00 0 0 0

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:mana
  • tree:elemental
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Cast time of your next Lightning Bolt, Chain Lightning or Lava Burst spell is reduced by $s1%.
  • description:When activated, your next Lightning Bolt, Chain Lightning or Lava Burst spell becomes an instant cast spell. In addition, your Fire, Frost, and Nature damage is increased by $64701s2%$?s55452[, you take $55452s1% less damage from all sources,][] and you gain $64701s1% spell haste for $64701d.
flame_shock 1836 6.9% 17.7 26.23sec 46786 39855 3856 8092 10516 35.6% 0.0% 0.0% 0.0% 202 2615 5488 35.5% 0.0% 99.6%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.74 17.74 202.19 202.19 1.1739 2.2277 830055
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 64.41% 3855.91 3316 5031 44065
crit 6.3 35.59% 8091.78 6930 10516 51090
Tick Results Count Pct Average Min Max Total Damage
hit 130.4 64.50% 2615.03 2226 3429 341048
crit 71.8 35.50% 5487.76 4653 7167 393853

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:9
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 2374 8.9% 30.5 14.57sec 35232 0 27492 57816 87855 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.47 30.47 0.00 0.00 0.0000 0.0000 1073349
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.48% 27491.51 16522 42036 623774
crit 7.8 25.52% 57816.47 34530 87855 449575

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
lava_burst 5104 19.1% 61.5 7.39sec 37520 31165 0 37620 54380 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.51 61.35 0.00 0.00 1.2039 0.0000 2307969
Direct Results Count Pct Average Min Max Total Damage
crit 61.3 100.00% 37619.83 32364 54380 2307969

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.828000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_burst_overload 1515 5.7% 25.3 17.61sec 27064 0 12258 27173 37607 99.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.31 25.25 0.00 0.00 0.0000 0.0000 685066
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 0.25% 12258.43 11086 15411 776
crit 25.2 99.75% 27172.72 22381 37607 684291

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.622000
  • base_dd_min:1047.17
  • base_dd_max:1335.47
lightning_bolt 9411 35.3% 219.9 2.04sec 19353 13592 15129 31878 46051 25.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
219.91 219.20 0.00 0.00 1.4239 0.0000 4255941
Direct Results Count Pct Average Min Max Total Damage
hit 163.1 74.41% 15129.34 12808 22034 2467515
crit 56.1 25.59% 31877.89 26769 46051 1788426

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.914000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_bolt_overload 2793 10.5% 90.5 4.92sec 13963 0 10912 23008 33307 25.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.45 90.15 0.00 0.00 0.0000 0.0000 1262962
Direct Results Count Pct Average Min Max Total Damage
hit 67.1 74.40% 10912.45 9264 15936 731891
crit 23.1 25.60% 23007.64 19361 33307 531071

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.686000
  • base_dd_min:539.17
  • base_dd_max:615.99
searing_totem 1821 6.8% 6.0 60.34sec 138324 137563 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3190 6704 25.4% 0.0% 71.3%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 201.64 201.64 1.0055 1.6000 823307
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.4 74.58% 3189.59 2741 4281 479632
crit 51.3 25.42% 6703.88 5729 8947 343675

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - fire_elemental 3699
fire_blast 433 11.7% 12.0 9.86sec 4410 0 4279 8558 9333 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 52916
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.95% 4279.28 3822 4667 49786
crit 0.4 3.05% 8557.86 7645 9333 3130

Action details: fire_blast

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:302.1
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:276.00
  • base_dd_max:321.00
fire_melee 2137 57.8% 23.0 4.93sec 11346 3566 12005 41949 45890 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 3.1818 0.0000 260954
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 75.81% 12004.55 10699 13111 209320
crit 0.0 0.21% 41948.51 37447 45890 1980
glance 5.5 23.98% 9001.75 8024 9834 49655

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.135000
  • base_dd_min:427.00
  • base_dd_max:460.00
fire_nova 1002 27.1% 12.0 9.86sec 10195 5098 9901 19773 21608 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 2.0000 0.0000 122344
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 97.02% 9901.46 8836 10804 115281
crit 0.4 2.98% 19772.93 17672 21608 7063

Action details: fire_nova

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:233.8
  • cooldown:7.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:583.00
  • base_dd_max:663.00
fire_shield 127 3.4% 40.9 3.00sec 378 126 367 736 830 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.92 40.92 0.00 0.00 3.0000 0.0000 15468
Direct Results Count Pct Average Min Max Total Damage
hit 39.7 97.02% 367.00 0 415 14571
crit 1.2 2.98% 736.36 0 830 897

Action details: fire_shield

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.032000
  • base_dd_min:89.00
  • base_dd_max:89.00
pet - earth_elemental 587
earth_melee 587 100.0% 58.0 2.00sec 1250 625 1289 2579 2660 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 2.0000 0.0000 72502
Direct Results Count Pct Average Min Max Total Damage
hit 42.3 72.97% 1288.71 1144 1330 54541
crit 1.7 3.00% 2579.43 2288 2660 4485
glance 13.9 24.03% 966.75 858 997 13475

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Elemental_T11_372
bloodlust mana 0.0% 0.0 1
earth_elemental_totem mana 1.0% 0.0 5623
earth_shock mana 16.8% 2.9 3018
fire_elemental_totem mana 1.0% 0.0 5388
flame_shock mana 9.7% 15.6 2991
lava_burst mana 20.4% 20.7 1817
lightning_bolt mana 40.5% 19.2 1009
searing_totem mana 1.3% 118.1 1171
pet - fire_elemental
fire_blast mana 56.4% 14.6 302
fire_nova mana 43.6% 43.8 233
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 26908.5 14.9 8.8%
flask mana 1.0 5700.0 5700.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 106835.0 106835.0 0.0%
mp5_regen mana 1809.6 96900.0 53.5 8.5%
replenishment mana 1809.6 51104.2 28.2 8.1%
rolling_thunder mana 185.8 372232.7 2003.1 18.6%
pet - fire_elemental mana
initial_mana none 1.0 47529.1 47529.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.1sec 47.1sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
elemental_focus 85.4 54.2 5.3sec 3.2sec 68% 68%

Database details

  • id:16246
  • cooldown name:buff_elemental_focus
  • tooltip:Your next $n damage or healing spells have their mana cost reduced by $s1%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 6.6 0.0 74.1sec 74.1sec 22% 24%

Database details

  • id:64701
  • cooldown name:buff_elemental_mastery
  • tooltip:Fire, Frost, and Nature damage increased by $s2%. Casting speed of all spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.6sec 48.6sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 113.2sec 113.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 1.0 0.0 339.3sec 339.3sec 4% 4%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
fire_elemental-casting 1.0 51.9 0.0sec 2.3sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:9
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
fulmination_4 2.9 97.9sec
fulmination_5 2.6 102.3sec
fulmination_6 25.0 17.8sec
lava_surge 40.4 11.0sec
rolling_thunder 185.8 2.4sec
wasted_lightning_shield 8.7 44.2sec

Statistics & Data Analysis

DPS
Population
Convergence 71.45%
σ of the average dps 5.8871
2 * σ / μ 0.0441%
95% Confidence Intervall ( μ ± 2σ ) ( 26668.11 - 26691.66 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26662.23 - 26697.55 )
Sample Data
σ 588.7127
Minimum 24669.67
Maximum 29297.32
Spread ( max - min ) 4627.65
Range ( max - min ) / 2 2313.83
Range% 8.67
10th Percentile 25952.41
90th Percentile 27469.64
( 90th Percentile - 10th Percentile ) 1517.23
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1947
0.1 scale factor error with delta=300 3080
0.05 scale factor error with delta=300 12322
0.01 scale factor error with delta=300 308073
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 flametongue_weapon,weapon=main
3 lightning_shield
4 mana_spring_totem
5 wrath_of_air_totem
6 snapshot_stats
7 volcanic_potion,if=!in_combat|buff.bloodlust.react
8 wind_shear
9 bloodlust,health_percentage<=25
A bloodlust,if=target.time_to_die<=60
B berserking
C elemental_mastery
D unleash_elements,moving=1
E flame_shock,if=!ticking|ticks_remain<3
F lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
G earth_shock,if=buff.lightning_shield.stack=9
H earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
I fire_elemental_totem
J earth_elemental_totem
K searing_totem
L spiritwalkers_grace,moving=1
M chain_lightning,if=target.adds>2
N lightning_bolt
O thunderstorm

Sample Sequence

01237ABCEFFIJNNNFNFNNNNNGNNFNFNENNNNFGNNNNNFNFNFNGNNNEFNNGNNNFNFNFNNCFHNNNNEFNNNGNNNFNGNNNNFNENNNGFNNNNNFNFKNNENNFGNNFNNFNNNCNNGFNNNEFNNNNFGFNNNNNNFHBNNNEKNFNNNNFGNNFNFNNNENNFGNNNNNCFNNNNGNFNNENNNNFGKNNNFNNGNNNEFNNFNGFNNNNNNFNFHNNNENFNNGCNNNNFKNNFNHNNNENFNGNNNNFNNFNNGNNNEFNNNGNFNNNNBNNFGKNNNECNFNNNFGFNNFNNNNNNFHNFNENFNNNNNGFNNNFHNNNEKFNNGNNNFNFNGNNCNNEFNNNGNNNFNGNNNFNFHNNFEFNNNKNNFNNNNGNFNENNFNFNNNNFNNGCNNNFENNFNFGNNNBNNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 736 152 20
Agility 683 102 20
Stamina 7631 6009 5861
Intellect 6097 5314 4926
Spirit 983 983 826
Health 143601 120963 0
Mana 113885 102860 0
Spell Power 10276 7511 2207
Spell Hit 17.03% 17.03% 919
Spell Crit 21.32% 15.11% 309
Spell Haste 19.90% 14.19% 1817
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 2436 466 0
Melee Hit 7.65% 7.65% 919
Melee Crit 14.75% 7.96% 309
Melee Haste 14.19% 14.19% 1817
Expertise 0.00 0.00 0
Armor 19472 15396 15396
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.92% 2.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 18.23% 18.23% 1834

Gear

Encoded
head headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
tabard empty

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 3
Call of Flame 2
Elemental Warding 0
Reverberation 2
Elemental Precision 3
Rolling Thunder 2
Elemental Focus 1
Elemental Reach 2
Elemental Oath 2
Lava Flows 3
Fulmination 1
Elemental Mastery 1
Earth's Grasp 0
Totemic Wrath 1
Feedback 3
Lava Surge 2
Earthquake 1
Enhancement Rank
Elemental Weapons 2
Focused Strikes 0
Improved Shields 3
Elemental Devastation 0
Flurry 0
Ancestral Swiftness 2
Totemic Reach 2
Toughness 0
Stormstrike 0
Static Shock 0
Frozen Power 0
Improved Fire Nova 0
Searing Flames 0
Earthen Power 0
Shamanistic Rage 0
Unleashed Rage 0
Maelstrom Weapon 0
Improved Lava Lash 0
Feral Spirit 0
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Elemental_T11_372
origin="http://chardev.org/?profile=14385"
level=85
race=troll
role=spell
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
glyphs=chain_lightning/thunder/healing_stream_totem/thunderstorm/astral_recall/renewed_life/flame_shock/lightning_bolt/lava_burst
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/flametongue_weapon,weapon=main
actions+=/lightning_shield
actions+=/mana_spring_totem
actions+=/wrath_of_air_totem
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat|buff.bloodlust.react
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/berserking
actions+=/elemental_mastery
actions+=/unleash_elements,moving=1
actions+=/flame_shock,if=!ticking|ticks_remain<3
actions+=/lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
actions+=/earth_shock,if=buff.lightning_shield.stack=9
actions+=/earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains actions+=/fire_elemental_totem
actions+=/earth_elemental_totem
actions+=/searing_totem
actions+=/spiritwalkers_grace,moving=1
actions+=/chain_lightning,if=target.adds>2
actions+=/lightning_bolt
actions+=/thunderstorm
head=headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders=shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
chest=circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist=lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs=kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet=boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists=chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands=gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5861
# gear_intellect=4926
# gear_spirit=826
# gear_spell_power=2207
# gear_hit_rating=919
# gear_crit_rating=309
# gear_haste_rating=1817
# gear_mastery_rating=1834
# gear_armor=15396
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Shaman_Enh_T11_372 : 26688dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26688.1 10.74 / 0.04% 35.4 753.7 752.0 mana 18.53% 36.8
Origin http://chardev.org/?profile=39863
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:23684|19447|14767|9848|8480|3262|2958|1476|653&chds=0,47368&chco=C41F3B,C41F3B,336600,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23684++lava_lash,C41F3B,0,0,15|t++19447++flame_shock,C41F3B,1,0,15|t++14767++lightning_bolt,336600,2,0,15|t++9848++stormstrike,C79C6E,3,0,15|t++8480++earth_shock,336600,4,0,15|t++3262++wolf_melee,C79C6E,5,0,15|t++2958++melee_main_hand,C79C6E,6,0,15|t++1476++melee_off_hand,C79C6E,7,0,15|t++653++earth_melee,C79C6E,8,0,15&chtt=Shaman_Enh_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:13,11,11,10,10,8,5,5,4,4,4,3,3,3,2,2,1,1&chds=0,100&chco=C41F3B,336600,C79C6E,C79C6E,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,336600,336600,C79C6E,C41F3B,C41F3B,336600,C79C6E,C79C6E,C79C6E&chl=lava_lash|lightning_bolt|melee_main_hand|windfury_mh|searing_totem|flametongue_oh|melee_off_hand|flame_shock|stormstrike_mh|earth_shock|darkmoon_card_hurricane|wolf_melee|searing_flames|unleash_flame|lightning_shield|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776666555555566667777666777777677776777777666677777766666777776677777777766666777777766677777777777777777666677777776776777776677666666666666777777766677777766677777776666777777777766777777777777777766667777777666777777766777777777666777777776667777766666666777666667777777677777777766677777777667777777767777777777677777777776677777777667777777766777777777776666776666666666666666666766666667777766666767767666677777776666667776666666776666666676666&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=25279&chtt=Shaman_Enh_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y55555454557787655554523223210zyywwvvvvvvvuutsrqqppppppppqqqqqpppooooppqqrrrrrqqpppppppqqqqqqqqppppppppqqrrrqqpppppqpqqqrrsstttstttttuuuvvvvvvvuuttttttttttttssrrqqqqqqqppppoooooonnnnooopppoopppoooooppppppppoooooooooppppppppoooooooooppppppppppqqqrrsstttttttttttuuuuuuuuuuuttttssssssssrrrqqpppppppppppppooooooooopppppppppooooooopppppppppoooooooppppppooooooopppppqqqqqrrrrrsssstttttttttttttttuuuuuuutttsssssrrrrqqqpppppoooooooooooooopoooooooopppoooooppppp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26688|max=36597&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,4,0,7,9,8,12,19,36,62,71,127,137,207,253,349,369,427,487,518,600,612,688,624,623,551,529,506,427,370,300,270,185,179,114,88,67,57,39,21,10,13,10,4,2,1,3,0,1,1&chds=0,688&chbh=5&chxt=x&chxl=0:|min=24725|avg=26688|max=28991&chxp=0,1,46,100&chtt=Shaman_Enh_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372 26688
darkmoon_card_hurricane 974 3.6% 38.5 12.02sec 11445 0 7954 16385 16385 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.50 38.50 0.00 0.00 0.0000 0.0000 440613
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 58.58% 7953.66 7954 7954 179378
crit 15.9 41.42% 16384.54 16385 16385 261235

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1013 3.8% 40.2 11.12sec 11405 8480 8809 13612 17108 54.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.19 40.19 0.00 0.00 1.3449 0.0000 458365
Direct Results Count Pct Average Min Max Total Damage
hit 18.4 45.67% 8808.83 8337 11073 161691
crit 21.8 54.23% 13611.70 12880 17108 296674
miss 0.0 0.10% 0.00 0 0 0

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1324 5.0% 23.0 19.96sec 26079 19447 6012 9300 12271 19.3% 0.1% 0.0% 0.0% 155 2599 4015 19.3% 0.0% 90.8%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.97 22.97 155.41 155.41 1.3410 2.6440 598994
Direct Results Count Pct Average Min Max Total Damage
hit 18.5 80.65% 6012.17 4647 7942 111371
crit 4.4 19.25% 9300.19 7180 12271 41125
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.3 80.66% 2599.19 1992 3481 325798
crit 30.1 19.34% 4015.36 3078 5377 120700

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 2197 8.2% 339.4 1.33sec 2928 0 2651 4096 5174 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
339.35 339.35 0.00 0.00 0.0000 0.0000 993658
Direct Results Count Pct Average Min Max Total Damage
hit 273.5 80.58% 2651.49 2495 3349 725073
crit 65.6 19.32% 4095.92 3855 5174 268585
miss 0.3 0.09% 0.00 0 0 0

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_lash 3471 13.0% 43.7 10.45sec 35944 23684 24996 51585 63098 41.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.69 43.69 0.00 0.00 1.5176 0.0000 1570248
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 58.67% 24995.57 18292 30630 640612
crit 18.0 41.25% 51585.17 37682 63098 929637
dodge 0.0 0.08% 0.00 0 0 0

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3037 11.4% 69.5 6.47sec 19775 14767 14699 22668 29138 63.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
69.47 69.44 0.00 0.00 1.3391 0.0000 1373688
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 35.97% 14698.97 13799 18860 367182
crit 44.4 63.94% 22668.45 21319 29138 1006506
miss 0.1 0.09% 0.00 0 0 0

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 638 2.4% 41.9 10.83sec 6881 0 5463 8418 10738 52.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.93 41.93 0.00 0.00 0.0000 0.0000 288499
Direct Results Count Pct Average Min Max Total Damage
hit 18.8 44.95% 5462.80 5130 6950 102946
crit 22.0 52.57% 8418.23 7926 10738 185553
miss 0.0 0.10% 0.00 0 0 0
none 1.0 2.39% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2894 10.8% 285.3 1.59sec 4588 2958 3498 7212 8743 41.4% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
285.28 285.28 0.00 0.00 1.5513 0.0000 1308943
Direct Results Count Pct Average Min Max Total Damage
hit 79.1 27.72% 3498.33 3338 4244 276680
crit 118.2 41.44% 7211.71 6876 8743 852518
glance 68.5 24.00% 2624.97 2503 3183 179745
dodge 0.2 0.09% 0.00 0 0 0
miss 19.3 6.75% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1443 5.4% 284.4 1.59sec 2295 1476 1749 3606 4371 41.5% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
284.44 284.44 0.00 0.00 1.5547 0.0000 652650
Direct Results Count Pct Average Min Max Total Damage
hit 78.7 27.67% 1748.92 1669 2122 137623
crit 118.0 41.47% 3605.75 3438 4371 425369
glance 68.3 24.02% 1312.31 1252 1592 89659
dodge 0.2 0.09% 0.00 0 0 0
miss 19.2 6.75% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 790 3.0% 279.6 1.62sec 1279 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 2723 4208 14.3% 0.0% 80.8%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.59 279.59 121.78 121.78 0.0000 3.0000 357492
Direct Results Count Pct Average Min Max Total Damage
hit 279.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.4 85.71% 2723.38 716 4945 284266
crit 17.4 14.29% 4207.76 1106 7640 73226

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:755.38
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 2603 9.8% 8.1 59.76sec 145638 143384 0 0 0 0.0% 0.0% 0.0% 0.0% 280 3810 5886 19.3% 0.0% 99.0%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.08 8.08 279.84 279.59 1.0157 1.6000 1177437
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 225.5 80.66% 3809.60 3578 4944 859074
crit 54.1 19.34% 5886.34 5528 7639 318364

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 123.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.16 4.16 0.00 0.00 1.2919 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1569 5.9% 47.6 9.50sec 14917 9848 0 0 0 0.0% 0.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.57 47.57 0.00 0.00 1.5146 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 47.2 99.18% 0.00 0 0 0
dodge 0.4 0.82% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 1045 3.9% 47.2 9.58sec 10021 0 6969 14362 17431 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.18 47.18 0.00 0.00 0.0000 0.0000 472762
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 58.71% 6968.74 6655 8462 193034
crit 19.5 41.29% 14361.53 13709 17431 279728

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 523 2.0% 47.2 9.58sec 5019 0 3490 7194 8716 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.18 47.18 0.00 0.00 0.0000 0.0000 236777
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 58.72% 3489.91 3327 4231 96676
crit 19.5 41.28% 7193.50 6855 8716 140101

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.7 15.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.73 28.73 0.00 0.00 1.3380 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.7 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 670 2.5% 28.7 15.94sec 10550 0 9550 14748 18328 19.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.73 28.73 0.00 0.00 0.0000 0.0000 303139
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.53% 9549.61 9046 11934 220969
crit 5.6 19.39% 14748.13 13975 18328 82169
miss 0.0 0.08% 0.00 0 0 0

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 399 1.5% 28.7 15.94sec 6277 0 4372 9007 10828 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.73 28.73 0.00 0.00 0.0000 0.0000 180367
Direct Results Count Pct Average Min Max Total Damage
hit 16.9 58.69% 4372.33 4172 5272 73715
crit 11.8 41.22% 9006.74 8595 10828 106652
dodge 0.0 0.09% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 2628 9.8% 140.9 9.53sec 8435 0 5867 12091 14231 41.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.92 140.92 0.00 0.00 0.0000 0.0000 1188764
Direct Results Count Pct Average Min Max Total Damage
hit 82.5 58.56% 5866.66 5640 6908 484123
crit 58.3 41.35% 12091.35 11617 14231 704641
dodge 0.1 0.09% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 936
wolf_melee 936 100.0% 89.1 4.68sec 4401 3262 4672 9342 10970 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.14 89.14 0.00 0.00 1.3493 0.0000 392303
Direct Results Count Pct Average Min Max Total Damage
hit 67.5 75.75% 4672.30 4448 5485 315495
crit 0.2 0.20% 9342.28 8897 10970 1704
glance 21.4 24.05% 3503.76 3336 4114 75104

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 601
earth_melee 601 100.0% 59.0 2.00sec 1306 653 1346 2692 2815 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 77062
Direct Results Count Pct Average Min Max Total Damage
hit 43.0 72.92% 1346.32 1315 1407 57921
crit 1.8 3.05% 2692.47 2629 2815 4845
glance 14.2 24.00% 1009.73 986 1056 14296
dodge 0.0 0.03% 0.00 0 0 0

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372
earth_elemental_totem mana 0.4% 0.0 1406
earth_shock mana 12.4% 10.8 1054
flame_shock mana 6.7% 26.2 996
flametongue_oh mana 35.0% 8.3 351
lava_lash mana 12.0% 38.4 937
lightning_bolt mana 2.3% 173.6 114
searing_totem mana 0.7% 497.5 293
spirit_wolf mana 0.9% 0.0 703
stormstrike mana 26.1% 8.0 1874
unleash_elements mana 3.5% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 20221.7 11.2 31.5%
initial_mana none 1.0 25595.0 25595.0 0.0%
mp5_regen mana 1809.6 74341.2 41.1 29.8%
primal_wisdom mana 323.8 237614.1 733.8 37.4%
replenishment mana 1809.6 7986.8 4.4 31.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 9.3 83.4 49.0sec 4.8sec 92% 92%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 922.9 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 71.9 291.4 6.3sec 1.2sec 86% 86%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.8 7.8 37.5sec 21.9sec 40% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 10.4 5.0 41.9sec 27.5sec 34% 35%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 70.3 280.6 6.5sec 1.3sec 79% 86%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.5 45.7 202.3sec 9.6sec 98% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 339.0sec 339.0sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.7 0.0 15.9sec 15.9sec 33% 78%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.7 0.0 15.9sec 15.9sec 21% 30%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 38.5 12.0sec
flametongue_icd 16.5 26.0sec
maelstrom_weapon 350.8 1.5sec
static_shock 40.9 10.9sec
swings_clipped_mh 5.8 63.8sec
swings_clipped_oh 6.1 62.1sec
wasted_maelstrom_weapon 29.5 16.7sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.63%
σ of the average dps 5.3681
2 * σ / μ 0.0402%
95% Confidence Intervall ( μ ± 2σ ) ( 26677.41 - 26698.88 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26672.04 - 26704.25 )
Sample Data
σ 536.8076
Minimum 24725.02
Maximum 28990.90
Spread ( max - min ) 4265.88
Range ( max - min ) / 2 2132.94
Range% 7.99
10th Percentile 26018.69
90th Percentile 27386.99
( 90th Percentile - 10th Percentile ) 1368.29
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1618
0.1 scale factor error with delta=300 2561
0.05 scale factor error with delta=300 10245
0.01 scale factor error with delta=300 256144
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react

Sample Sequence

012378AEFGIJLHMNKQGLKIHLGJQLKQGIKLHJGQLHIKQGLJFHKGHILHKGLHJQIGKHLHKGLIHJHGLKHIGJFHELKGMHIKLQGJQLKIGHLKQGJLHIKGHLKGFIJHLKGQLHIJGLQKLGHIJHLGKHLKIGQJLFQGEKILHMJGLQKIGLKQKGLIJHLGHKLIJGHLFKQGQIJLHGKQLQIJGHLKQGKILHJGQLKIHGKFLHEKGLIHJMLGHKLHIGJLQKGQLIKQGLHJQFGIHKLHGKLHIJQGLHKLGIJHLKGHLKIQGJHLFHKQGEILHKGHJLHIMKGHLHKGIHJLQGKLQIJGHFKLQG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7775 5075 4756
Stamina 7541 5924 5775
Intellect 163 156 20
Spirit 178 178 20
Health 142355 119773 0
Mana 25595 25490 0
Spell Power 11357 5448 0
Spell Hit 16.91% 16.91% 1712
Spell Crit 16.13% 11.12% 1018
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 18248 10603 190
Melee Hit 20.25% 20.25% 1712
Melee Crit 40.53% 27.22% 1018
Melee Haste 5.13% 5.13% 657
Expertise 22.65 22.65 440
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 24.24% 16.86% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.20% 17.20% 1650

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372
origin="http://chardev.org/?profile=39863"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4756
# gear_stamina=5775
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=440
# gear_hit_rating=1712
# gear_crit_rating=1018
# gear_haste_rating=657
# gear_mastery_rating=1650
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Shaman_Enh_T11_372_Caster : 26755dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26755.3 8.63 / 0.03% 29.7 901.0 896.6 mana 6.39% 40.8
Origin http://chardev.org/?profile=39882
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:23431|22749|17626|16690|10041|6990|3199|2439|1442|741&chds=0,46862&chco=C41F3B,C41F3B,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23431++lava_lash,C41F3B,0,0,15|t++22749++flame_shock,C41F3B,1,0,15|t++17626++lightning_bolt,336600,2,0,15|t++16690++lava_burst,C41F3B,3,0,15|t++10041++earth_shock,336600,4,0,15|t++6990++stormstrike,C79C6E,5,0,15|t++3199++wolf_melee,C79C6E,6,0,15|t++2439++melee_main_hand,C79C6E,7,0,15|t++1442++melee_off_hand,C79C6E,8,0,15|t++741++earth_melee,C79C6E,9,0,15&chtt=Shaman_Enh_T11_372_Caster+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x390&cht=p&chf=bg,s,333333&chd=t:14,13,12,7,7,6,6,6,4,4,4,3,3,3,3,2,2,1,1&chds=0,100&chco=336600,C41F3B,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C79C6E,336600,C79C6E,C41F3B,C79C6E,C41F3B,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E&chl=lightning_bolt|lava_lash|searing_totem|lava_burst|melee_main_hand|flametongue_oh|flame_shock|windfury_mh|earth_shock|melee_off_hand|searing_flames|wolf_melee|unleash_flame|lightning_shield|darkmoon_card_hurricane|stormstrike_mh|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372_Caster+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777777665444456345544445565444334566544444445554444444455555554455666654433334444455555555444333445566544333344444444555555554444555666654433444455554444444444444555554433334444455555556554334445555544333344444444444454444444455555444333444555555555544444444555555444444444444444444444444444555544444445555554444444444444445555444433444444444444444444444445555555444444444455555554444444555544443334444444444444444444445555555444334444444444444444444&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=27782&chtt=Shaman_Enh_T11_372_Caster+Mana+Timeline&chts=dddddd,18&chco=2459FF http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y4434344433677755555652333321110zxywwwvwvvvuttssrqppppopqqqqqqppppppoppqqrqrrrrqqqqqpppqqqrrqqqqqqqppqqqqqrrrqqqqqqqqqqqrrssttsssstttuuuuuuuvvvvuuuuttttttttsssrrrqqqppqpppppppooooooooooopppoppppooooppppppppppppppooooopppppppooooooooppppqqqqqqqqqrrrssttuttttttttuuuuuuuuuuuutttsssssssrrrrqppooooooooooopppooooooopppppppppppooooopppppppppppppooopppppppoooooooppppqqqrrrrrrssssssttttttttttttttuuuuuuuttttsssrrrqqqqpppppooooooooooooopppppppoooopppppppppooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26755|max=36612&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,5,7,13,7,23,33,36,66,78,122,166,181,240,302,330,415,444,534,575,669,645,629,601,542,519,468,428,422,297,267,240,184,124,102,87,61,36,38,27,7,9,7,1,5,2,2,0,1,1&chds=0,669&chbh=5&chxt=x&chxl=0:|min=25283|avg=26755|max=28601&chxp=0,1,44,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372_Caster 26755
darkmoon_card_hurricane 746 2.8% 29.3 15.68sec 11510 0 8040 16562 16562 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.33 29.33 0.00 0.00 0.0000 0.0000 337523
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 59.29% 8039.87 8040 8040 139778
crit 11.9 40.71% 16562.13 16562 16562 197745

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1185 4.4% 39.7 11.24sec 13494 10041 10427 16111 19757 54.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.71 39.71 0.00 0.00 1.3439 0.0000 535882
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 46.04% 10427.37 10022 12787 190628
crit 21.4 53.96% 16111.02 15483 19757 345254

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1548 5.8% 22.9 20.05sec 30617 22749 7013 10834 14164 19.1% 0.0% 0.0% 0.0% 155 3063 4731 19.0% 0.0% 90.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.87 22.87 154.81 154.81 1.3459 2.6558 700285
Direct Results Count Pct Average Min Max Total Damage
hit 18.5 80.89% 7012.63 5582 9167 129741
crit 4.4 19.11% 10833.70 8624 14164 47358
Tick Results Count Pct Average Min Max Total Damage
hit 125.4 81.01% 3062.63 2427 4050 384077
crit 29.4 18.99% 4730.56 3750 6258 139108

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 1735 6.5% 272.8 1.66sec 2877 0 2607 4028 5146 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
272.84 272.84 0.00 0.00 0.0000 0.0000 784895
Direct Results Count Pct Average Min Max Total Damage
hit 221.1 81.03% 2607.31 2468 3331 576411
crit 51.8 18.97% 4027.69 3813 5146 208484

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_burst 1997 7.5% 29.8 14.89sec 30295 16690 0 30306 41647 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.81 29.80 0.00 0.00 1.8152 0.0000 903164
Direct Results Count Pct Average Min Max Total Damage
crit 29.8 100.00% 30306.28 27821 41647 903164

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_lash 3346 12.5% 42.8 10.67sec 35358 23431 24674 50935 62931 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.81 42.81 0.00 0.00 1.5090 0.0000 1513522
Direct Results Count Pct Average Min Max Total Damage
hit 25.4 59.32% 24674.33 18215 30549 626484
crit 17.4 40.68% 50934.98 37523 62931 887038

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3811 14.2% 72.5 6.20sec 23782 17626 17674 27264 34011 63.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.48 72.46 0.00 0.00 1.3493 0.0000 1723743
Direct Results Count Pct Average Min Max Total Damage
hit 26.2 36.22% 17673.61 16897 22013 463805
crit 46.2 63.78% 27263.89 26106 34011 1259938

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 749 2.8% 41.1 11.07sec 8233 0 6542 10087 12493 52.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.12 41.12 0.00 0.00 0.0000 0.0000 338567
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 45.39% 6542.25 6246 8086 122115
crit 21.5 52.18% 10087.38 9651 12493 216452
none 1.0 2.43% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 1796 6.7% 311.2 1.46sec 2610 2439 2012 4147 5234 40.8% 7.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
311.25 311.25 0.00 0.00 1.0699 0.0000 812323
Direct Results Count Pct Average Min Max Total Damage
hit 86.1 27.68% 2012.34 1913 2541 173362
crit 126.9 40.77% 4147.21 3942 5234 526287
glance 74.6 23.98% 1509.58 1435 1906 112673
dodge 1.5 0.49% 0.00 0 0 0
miss 22.0 7.07% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1036 3.9% 210.3 2.15sec 2227 1442 1712 3528 4313 40.7% 7.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.35 210.35 0.00 0.00 1.5442 0.0000 468466
Direct Results Count Pct Average Min Max Total Damage
hit 59.3 28.19% 1711.91 1641 2094 101507
crit 85.6 40.71% 3528.19 3380 4313 302138
glance 50.5 24.00% 1284.16 1230 1570 64821
miss 14.9 7.10% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 967 3.6% 279.2 1.62sec 1566 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 3327 5145 14.0% 0.0% 81.0%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.21 279.21 122.05 122.05 0.0000 3.0000 437222
Direct Results Count Pct Average Min Max Total Damage
hit 279.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.9 85.97% 3327.40 883 5795 349123
crit 17.1 14.03% 5144.82 1364 8953 88099

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:962.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 3145 11.8% 8.1 59.91sec 176341 174054 0 0 0 0.0% 0.0% 0.0% 0.0% 279 4617 7133 19.0% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.07 8.07 279.21 279.21 1.0131 1.6000 1422240
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 226.3 81.05% 4616.93 4413 5794 1044782
crit 52.9 18.95% 7132.90 6818 8951 377458

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 122.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.17 4.17 0.00 0.00 1.2974 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1088 4.1% 46.6 9.69sec 10556 6990 0 0 0 0.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.63 46.63 0.00 0.00 1.5101 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.4 99.50% 0.00 0 0 0
dodge 0.2 0.50% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 588 2.2% 46.4 9.74sec 5728 0 4002 8247 10435 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.39 46.39 0.00 0.00 0.0000 0.0000 265766
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.34% 4002.44 3815 5066 110180
crit 18.9 40.66% 8247.04 7859 10435 155586

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 501 1.9% 46.4 9.74sec 4881 0 3411 7029 8599 40.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.39 46.39 0.00 0.00 0.0000 0.0000 226439
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.37% 3410.90 3271 4174 93951
crit 18.8 40.63% 7028.66 6738 8599 132488

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.6 16.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 1.3413 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.6 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 787 2.9% 28.6 16.03sec 12462 0 11292 17446 21215 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 0.0000 0.0000 355928
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 81.00% 11292.29 10847 13768 261254
crit 5.4 19.00% 17446.40 16759 21215 94675

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 225 0.8% 28.6 16.03sec 3568 0 2510 5170 6496 40.3% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 0.0000 0.0000 101923
Direct Results Count Pct Average Min Max Total Damage
hit 16.9 59.23% 2510.31 2392 3153 42458
crit 11.5 40.28% 5169.66 4927 6496 59465
dodge 0.1 0.49% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 1548 5.8% 141.0 9.54sec 4964 0 3484 7179 8706 40.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
141.01 141.01 0.00 0.00 0.0000 0.0000 699994
Direct Results Count Pct Average Min Max Total Damage
hit 83.2 58.98% 3483.76 3348 4226 289736
crit 57.1 40.53% 7178.66 6897 8706 410258
dodge 0.7 0.49% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 919
wolf_melee 919 100.0% 89.4 4.68sec 4317 3199 4584 9167 10840 0.2% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.35 89.35 0.00 0.00 1.3494 0.0000 385737
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 75.73% 4583.52 4384 5420 310162
crit 0.2 0.20% 9166.82 8767 10840 1678
glance 21.5 24.06% 3437.21 3288 4065 73897

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 682
earth_melee 682 100.0% 59.0 2.00sec 1482 741 1528 3055 3182 3.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 87435
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 73.07% 1527.69 1498 1591 65862
crit 1.8 2.99% 3055.29 2997 3182 5390
glance 14.1 23.94% 1145.82 1124 1193 16184

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372_Caster
bloodlust mana 0.0% 0.0 1523
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 10.3% 12.8 1054
flame_shock mana 5.6% 30.7 996
flametongue_oh mana 23.5% 8.2 351
lava_burst mana 17.1% 12.9 2343
lava_lash mana 9.8% 37.7 937
lightning_bolt mana 7.7% 55.1 432
searing_totem mana 0.6% 602.4 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 21.4% 5.6 1874
unleash_elements mana 2.9% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 23836.5 13.2 19.2%
initial_mana none 1.0 28205.0 28205.0 0.0%
mp5_regen mana 1809.6 86442.6 47.8 18.4%
primal_wisdom mana 303.4 284927.0 939.1 19.8%
replenishment mana 1809.6 10334.1 5.7 19.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 4.7 118.6 93.2sec 3.6sec 97% 97%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 862.1 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 66.3 270.0 6.8sec 1.3sec 85% 85%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 9.9 4.4 44.2sec 29.6sec 31% 33%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.0 3.3 47.9sec 34.2sec 28% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 73.2 192.4 6.2sec 1.7sec 72% 67%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.4 45.0 225.1sec 9.7sec 99% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 339.1sec 339.1sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.6 0.0 16.0sec 16.0sec 28% 42%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.6 0.0 16.0sec 16.0sec 21% 29%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 29.3 15.7sec
flametongue_icd 11.8 35.9sec
maelstrom_weapon 265.6 1.9sec
static_shock 40.1 11.2sec
swings_clipped_mh 38.5 11.4sec
swings_clipped_oh 28.9 15.2sec
wasted_maelstrom_weapon 13.0 33.9sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 71.41%
σ of the average dps 4.3148
2 * σ / μ 0.0323%
95% Confidence Intervall ( μ ± 2σ ) ( 26746.63 - 26763.89 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26742.31 - 26768.20 )
Sample Data
σ 431.4825
Minimum 25282.50
Maximum 28600.58
Spread ( max - min ) 3318.08
Range ( max - min ) / 2 1659.04
Range% 6.20
10th Percentile 26217.74
90th Percentile 27323.87
( 90th Percentile - 10th Percentile ) 1106.12
Approx. Iterations needed for
1% dps error 10
0.1% dps error 1040
0.1 scale factor error with delta=300 1654
0.05 scale factor error with delta=300 6619
0.01 scale factor error with delta=300 165490
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
R lava_burst,if=dot.flame_shock.remains>cast_time+0.5

Sample Sequence

012378AEFGIJLHMNRKGLHQKIRLGHJQRLKGHIQKLQRGJLQIKQGLHKFQLGIJQRLKGQKLIQGJQLQRKGILHJQRGKLQIKQGLEFKQQGIJLMQRGKLQIJQGLRKLGIJQRLKGQKLIQFGJLQRKGILHJQRGKLQIKRGLHKQGIJLQRKGLQKIEFQLGJQRLKMGHIKLHGJQLQRIGKLQRKGLHIJRLGKFHRKIGLQJQRLGKHIQLJQGQRKLQIGHJLRKGQLIKQFQEGKLQJIGHLKMQRGKLHIJRGLKQRKGILHJQRGKLFHIKQGLJQRKGILQKRGLJHQIRGKHLQKRGIJHLRKFGLEQIJQRGKLMKGILHJRGLHKIRLGKQLJQGIQKFLQRG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7593 4901 4591
Stamina 7540 5923 5774
Intellect 337 321 185
Spirit 244 244 86
Health 142341 119759 0
Mana 28205 27965 0
Spell Power 13755 7646 2207
Spell Hit 17.15% 17.15% 1671
Spell Crit 15.79% 10.76% 908
Spell Haste 9.85% 4.62% 591
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 17848 10257 190
Melee Hit 19.91% 19.91% 1671
Melee Crit 39.36% 26.07% 908
Melee Haste 4.62% 4.62% 591
Expertise 24.02 24.02 481
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.79% 16.40% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.82% 17.82% 1760

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372_Caster
origin="http://chardev.org/?profile=39882"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
actions+=/lava_burst,if=dot.flame_shock.remains>cast_time+0.5
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4591
# gear_stamina=5774
# gear_intellect=185
# gear_spirit=86
# gear_spell_power=2207
# gear_attack_power=190
# gear_expertise_rating=481
# gear_hit_rating=1671
# gear_crit_rating=908
# gear_haste_rating=591
# gear_mastery_rating=1760
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=andoros_fist_of_the_dragon_king,heroic=1,weapon=mace_1.80speed_328min_611max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Warlock_AffDrain_T11_372 : 26653dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26652.5 10.25 / 0.04% 17.2 1551.2 1528.2 mana 0.00% 35.6
Origin http://chardev.org/?profile=36745
Talents http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:71887|21680|16758|15771|15643|13480|8995|8421|5113|1389|518&chds=0,143773&chco=9482C9,435133,9482C9,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++71887++unstable_affliction,9482C9,0,0,15|t++21680++fel_flame,435133,1,0,15|t++16758++shadowflame,9482C9,2,0,15|t++15771++shadow_bolt,9482C9,3,0,15|t++15643++drain_soul,9482C9,4,0,15|t++13480++soul_fire,C41F3B,5,0,15|t++8995++drain_life,9482C9,6,0,15|t++8421++haunt,9482C9,7,0,15|t++5113++lash_of_pain,9482C9,8,0,15|t++1389++infernal_melee,C79C6E,9,0,15|t++518++ebon_imp_melee,C79C6E,10,0,15&chtt=Warlock_AffDrain_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:19,15,15,14,13,9,4,3,3,1,1,1,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,9482C9,435133,C79C6E,9482C9,C79C6E,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|unstable_affliction|drain_life|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|shadow_bolt|fel_flame|infernal_melee|shadowflame|ebon_imp_melee|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_AffDrain_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s77665yuuuuuuuuutssrqqqqpoooooomlkjjjjiiiiihhfeeeeeeedddddcbbbbaZZZZZYYYXWVVVVVVVVUUTSSSSSSRRRRRQQQQQQQQQQQRRQQQPPPPPPPPPPOONNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNMMMMMMMMMMMMMMMNNNNOOOOOOOONOONONNNNNNNNNNMNNNNNNNNMMMMMMNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNMMMMMMMNMMNMMMMMNNNOOOOOOOOOPPPPPPPPPPPPOOOOOOOOPPPPPPPPPQQQQRRRRRSSSTTTUUUUUUVVVVWWWWWWWXXXXXXXXXXXXXWWWWWWXXXXYYYYYZZZZaaaaabbbbbbcccddddddeeeefffffgggghhhiiiiiiiiiijjjjkkklllllmmmmnn&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=106650&chtt=Warlock_AffDrain_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:lmpsqrstwxwz234586644101z10zyvutsqrqporqqqppnnmmlkkkknnmmmmjihhhihhghiiihheeeeedddefgggggfeeffgghhikkkklkkkkkkkkkmmmlllkjjjiiihhhijjjjihhhhhhhhijkkkkkiiiiiihhhijjjiigfeeeeeeegggfffedeeeefffghiiiihhhhhiiiiijjjjjihhhhhhhhijjkkkjiiiiiiiijkkkkkkjiiiiiiiijjkjjihgggfffffgghhhggfefffffghjjkkkjjjjjjjjjkllllkjiihhhhhhiijkkkkjjkkllmmnopqqrrqqppqqpqqqrrrqqponmmmmllmmmmmmlkkkkklllmnoppppoopppqqqqrrsssrqppooooooppppppoonnoooopqrsssssssssttuuvwxxxxwvvvvvvvwvwwww&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26653|max=42305&chxp=1,1,63,100&chtt=Warlock_AffDrain_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,5,8,15,27,32,54,69,136,176,216,295,307,426,461,491,584,620,600,630,574,601,533,547,470,387,341,282,243,204,166,123,89,83,55,40,36,19,12,13,8,5,6,3,1,0,2,0,1&chds=0,630&chbh=5&chxt=x&chxl=0:|min=24904|avg=26653|max=28753&chxp=0,1,45,100&chtt=Warlock_AffDrain_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_AffDrain_T11_372 26653
bane_of_doom 2330 8.7% 7.6 60.78sec 137828 134735 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26773 55401 33.1% 0.0% 96.4%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.64 7.64 29.05 29.05 1.0230 15.0000 1053325
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.87% 26772.95 18549 39652 520075
crit 9.6 33.13% 55400.84 38115 81480 533250

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3830 14.4% 1.0 1.04sec 1729164 1667292 0 0 0 0.0% 0.1% 0.0% 0.0% 208 5838 12078 40.0% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 207.67 207.67 1.0371 2.1677 1731412
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.96% 5838.50 3573 9537 726951
crit 83.2 40.04% 12078.49 7342 19598 1004461

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.55sec 3095 0 2698 4173 4896 27.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31290
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.72% 2698.17 2602 3169 19836
crit 2.7 27.15% 4172.65 4020 4896 11454
miss 0.0 0.13% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 2.9 134.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.89 2.89 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.9 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 3985 14.9% 101.4 3.28sec 17764 8995 0 0 0 0.0% 0.1% 0.0% 0.0% 230 6190 12834 24.9% 0.0% 36.4%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
101.40 101.40 229.58 229.58 1.9748 0.7171 1801243
Direct Results Count Pct Average Min Max Total Damage
hit 101.3 99.89% 0.00 0 0 0
miss 0.1 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 172.4 75.08% 6189.85 3701 9340 1066911
crit 57.2 24.92% 12834.44 7604 19193 734332

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3347 12.6% 13.1 8.77sec 115573 15643 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28229 58528 25.3% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.09 13.09 42.15 42.15 7.3880 2.2219 1513071
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.5 74.69% 28228.54 16496 40868 888674
crit 10.7 25.31% 58527.77 33897 83977 624398

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 304 1.1% 5.6 31.89sec 24415 21680 19321 40058 59641 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.63 5.63 0.00 0.00 1.1261 0.0000 137372
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.18% 19320.58 17198 29025 81724
crit 1.4 24.69% 40057.61 35339 59641 55648
miss 0.0 0.13% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 962 3.6% 45.2 9.99sec 9611 8421 7612 15790 24022 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.24 45.06 0.00 0.00 1.1414 0.0000 434832
Direct Results Count Pct Average Min Max Total Damage
hit 33.7 74.84% 7611.60 6621 11714 256667
crit 11.3 25.04% 15790.29 13606 24022 178165
miss 0.1 0.12% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17249 0 13235 27424 29899 28.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17249
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.54% 13235.15 10344 14551 9468
crit 0.3 28.37% 27423.60 21256 29899 7780
miss 0.0 0.09% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 4.3 53.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.26 4.26 0.00 0.00 1.0146 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 792 3.0% 20.1 16.15sec 17780 15771 14019 29123 45864 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.15 20.15 0.00 0.00 1.1274 0.0000 358186
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 74.89% 14018.91 12023 22320 211507
crit 5.0 25.00% 29123.15 24705 45864 146679
miss 0.0 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1086 4.1% 26.0 13.13sec 18924 16758 2509 5187 6805 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.95 25.95 0.00 0.00 1.1293 0.0000 82450
Direct Results Count Pct Average Min Max Total Damage
hit 19.4 74.86% 2508.87 2313 3312 48739
crit 6.5 25.04% 5186.78 4753 6805 33710
miss 0.0 0.10% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 904 3.4% 26.0 13.13sec 15747 0 0 0 0 25.1% 0.1% 0.0% 0.0% 113 2849 5915 25.0% 0.0% 35.8%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.95 25.95 113.01 113.01 0.0000 1.4328 408670
Direct Results Count Pct Average Min Max Total Damage
hit 19.4 74.83% 0.00 0 0 0
crit 6.5 25.05% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 84.7 74.99% 2849.23 2489 4196 241449
crit 28.3 25.01% 5915.35 5114 8622 167221

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 100 0.4% 3.0 46.25sec 15110 13480 11652 24230 29262 27.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1210 0.0000 45330
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.30% 11651.83 9322 14240 25273
crit 0.8 27.59% 24229.82 19154 29262 20057
miss 0.0 0.11% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4099 15.4% 22.6 15.37sec 82125 71887 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6242 12921 40.1% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.56 22.56 207.75 207.75 1.1424 2.1574 1852955
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.92% 6241.94 3818 10082 777001
crit 83.3 40.08% 12921.41 7846 20003 1075954

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5130
lash_of_pain 5130 100.0% 301.2 1.51sec 7696 5113 6114 12305 18163 26.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.16 301.16 0.00 0.00 1.5051 0.0000 2317828
Direct Results Count Pct Average Min Max Total Damage
hit 218.2 72.46% 6113.72 5396 9104 1334066
crit 79.9 26.55% 12305.04 10766 18163 983762
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3556
infernal_immolation 1150 32.3% 1.0 0.00sec 58867 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2704 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 58867
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 98.97% 2703.51 2215 3830 58867
miss 0.2 1.03% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2406 67.7% 58.0 0.75sec 2123 1389 2169 4447 5478 17.4% 14.5% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5284 0.0000 123116
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 44.13% 2169.10 1948 2739 55522
crit 10.1 17.39% 4447.17 3895 5478 44842
glance 13.9 23.95% 1638.25 1461 2054 22753
dodge 3.8 6.55% 0.00 0 0 0
miss 4.6 7.99% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 205
ebon_imp_melee 205 100.0% 102.7 0.78sec 792 518 822 1644 1644 16.8% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.71 102.71 0.00 0.00 1.5284 0.0000 81295
Direct Results Count Pct Average Min Max Total Damage
hit 45.8 44.61% 822.05 822 822 37667
crit 17.3 16.81% 1644.11 1644 1644 28379
glance 24.7 24.08% 616.54 617 617 15250
dodge 6.6 6.46% 0.00 0 0 0
miss 8.3 8.04% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_AffDrain_T11_372
bane_of_doom mana 3.4% 44.7 3082
corruption mana 0.2% 1402.4 1233
demon_soul mana 1.3% 0.0 3082
drain_life mana 35.7% 7.2 2466
drain_soul mana 5.4% 40.2 2877
fel_flame mana 1.0% 19.8 1233
haunt mana 15.9% 3.9 2466
infernal mana 2.3% 0.0 16442
shadow_bolt mana 5.0% 10.2 1746
shadowflame mana 19.0% 3.7 5138
soul_fire mana 0.8% 8.2 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 9.9% 26.6 3082
pet - succubus
lash_of_pain mana 100.0% 13.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29288.3 16.2 0.7%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 4.3 140581.2 32976.3 0.0%
mana_feed mana 79.9 370681.4 4636.5 0.8%
mp5_regen mana 1809.6 92260.9 51.0 0.7%
replenishment mana 1809.6 52157.1 28.8 0.7%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 4.3 439.6 103.1 99.5%
mana_spring_totem mana 1809.6 8865.0 4.9 70.0%
mp5_regen mana 1809.6 154019.4 85.1 61.6%
replenishment mana 1809.6 8826.0 4.9 69.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.6sec 106.6sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 68.9 0.0 6.6sec 6.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.5sec 46.5sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 2.9 0.0 134.2sec 134.2sec 13% 31%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.2 43.8 299.6sec 10.0sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.9 0.0 47.6sec 47.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.2 63.9 326.8sec 6.9sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 23.2 2.7 18.4sec 16.5sec 16% 100%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.2sec 46.2sec 0% 1%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.4sec 79.0sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.7sec
shadow_trance 25.9 16.5sec

Statistics & Data Analysis

DPS
Population
Convergence 68.24%
σ of the average dps 5.1267
2 * σ / μ 0.0385%
95% Confidence Intervall ( μ ± 2σ ) ( 26642.25 - 26662.76 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26637.13 - 26667.89 )
Sample Data
σ 512.6703
Minimum 24903.58
Maximum 28752.98
Spread ( max - min ) 3849.40
Range ( max - min ) / 2 1924.70
Range% 7.22
10th Percentile 25895.38
90th Percentile 27167.89
( 90th Percentile - 10th Percentile ) 1272.51
Approx. Iterations needed for
1% dps error 14
0.1% dps error 1479
0.1 scale factor error with delta=300 2336
0.05 scale factor error with delta=300 9345
0.01 scale factor error with delta=300 233627
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G soulburn
H soul_fire,if=buff.soulburn.up
I demon_soul,if=buff.shadow_trance.react
J shadow_bolt,if=buff.shadow_trance.react
K life_tap,mana_percentage<=5
L drain_life,interrupt=1
M life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
N fel_flame,moving=1
O life_tap

Sample Sequence

012346789ABDFGHLIJLLB9JLFLLBLLL9FJBLLLLB9FLLJLBGHJLF9LBALLFL9BLLLFBJ9LLLBFLL9GHLBLFLCCLBLLCF6CLABLL9LFBLLLL9BFLLLBL9FLLBLLL9FBKLLLAB9FLLLBLIJF9LKBJLLJFB9JLLLBFL9LLBLFL6L9ABLLFJLBL9LLLBKFLLL9BLFLLBL9LLFLBLJLL9BFALKLLBLCFCLBLL9LFBIJLLCLBCFJLJL9BLFLLB6KL9ALFLBJLLJ9LBFLLLJLBL9KFLLBLL9EBEBEAEBE7EBEBEBEBE6BEAEBEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 152668 128504 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 0
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_AffDrain_T11_372
origin="http://chardev.org/?profile=36745"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul,if=buff.shadow_trance.react
actions+=/shadow_bolt,if=buff.shadow_trance.react
actions+=/life_tap,mana_percentage<=5
actions+=/drain_life,interrupt=1
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Affliction_T11_372 : 26703dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26703.4 10.41 / 0.04% 19.2 1391.8 1235.0 mana 0.00% 36.9
Origin http://chardev.org/?profile=36750
Talents http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://7.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:72513|22025|16990|15663|13596|9962|8545|5110|1388|519&chds=0,145026&chco=9482C9,435133,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++72513++unstable_affliction,9482C9,0,0,15|t++22025++fel_flame,435133,1,0,15|t++16990++shadowflame,9482C9,2,0,15|t++15663++drain_soul,9482C9,3,0,15|t++13596++soul_fire,C41F3B,4,0,15|t++9962++shadow_bolt,9482C9,5,0,15|t++8545++haunt,9482C9,6,0,15|t++5110++lash_of_pain,9482C9,7,0,15|t++1388++infernal_melee,C79C6E,8,0,15|t++519++ebon_imp_melee,C79C6E,9,0,15&chtt=Warlock_Affliction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:19,18,15,14,13,9,4,3,1,1,1,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,435133,C79C6E,C79C6E,9482C9,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|unstable_affliction|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|fel_flame|infernal_melee|ebon_imp_melee|shadowflame|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Affliction_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t78644vrqpoonnmlkjjhfffedcccbbaYXWcjllllkkkjigfeeddddehlnooooonmlkkkjjihgfeddcccbbaZZYZZbeghijkkjjihgffeeffghhhhggggghhijjjjihggfedcbbaaZZZZabdgijkkkjjihhgffeeeddccbbaabbcdfghiijiihhggfedccccdegiklmnnmmllkjjihggffeedccbaaaaaabcddefghhhhhhggffffffffghijjkkkjjjiihhgffeedccbbaaaaabcdefghhiihhgggffeeeeddddcccccccddeeeeeeeeddccbbbaabbccdeeffffffeeddddcccbbbaaaaZZZZZZZZZZZZZZZZYYYYYYYYYYZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYXXXYYXXXXXXWWVVVVVVVVVVVVVUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105267&chtt=Warlock_Affliction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:gilooqrsvwwz125576656435220zyvutsrrppoqqppoolmlllkkjjlmllkkhhhhhggffghhhhheddddddddeeffffeeeeeefffhiijjkjijjjjjjjkllllljiiihihhhhijjjjiggggggghhijjjjjihhhhhhhhiiiiihgfeeeddddefffffeddddddeeefghhhgfffggggghhiijjiihhhhhhhhiijjjiihhhhhhhhijjjjjihhhhhhhhhijjiihgggfgfffgghhhhgffeeeeefgghiijjiiiiiiiijkkllkkjihhhhhhhiijjkkjjjjkkllmmnoppppppooooooppqqqpponmmmllllmmmmllkkkkkkkkllmnooooooooppppqqrrrrqqpoooonnooppppoonnnnnooppqrrrrrrrrsssttuvvwwwvuuuvvvvvvvvv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26703|max=43225&chxp=1,1,62,100&chtt=Warlock_Affliction_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,1,4,8,12,20,26,47,84,115,173,236,250,349,404,460,548,611,585,663,626,624,608,562,525,448,400,332,267,235,183,145,110,88,72,51,29,26,18,16,10,7,6,5,3,3,1,0,0,1&chds=0,663&chbh=5&chxt=x&chxl=0:|min=24895|avg=26703|max=28912&chxp=0,1,45,100&chtt=Warlock_Affliction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Affliction_T11_372 26703
bane_of_doom 2330 8.7% 7.6 60.94sec 138105 136596 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26798 55500 33.2% 0.0% 96.2%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.63 7.63 28.99 28.99 1.0110 15.0000 1053365
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.77% 26798.48 18549 39574 518738
crit 9.6 33.23% 55500.05 38115 81318 534626

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3869 14.5% 1.0 185.71sec 1686615 1621902 0 0 0 0.0% 0.1% 0.0% 0.0% 208 5874 12158 40.1% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.04 1.04 208.36 208.36 1.0399 2.1605 1749020
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.86% 0.00 0 0 0
miss 0.0 0.14% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 59.90% 5874.03 4002 9203 733115
crit 83.6 40.10% 12158.07 8224 18911 1015904

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.71sec 3091 0 2695 4173 4896 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.09 10.09 0.00 0.00 0.0000 0.0000 31179
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.88% 2695.40 2602 3169 19811
crit 2.7 27.01% 4172.86 4020 4896 11368
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_soul 3345 12.5% 13.1 8.72sec 115086 15663 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28268 58566 25.3% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.14 13.14 42.07 42.07 7.3478 2.2215 1512172
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.67% 28268.11 17335 40868 888043
crit 10.7 25.33% 58565.75 35621 83977 624129

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 304 1.1% 5.6 32.74sec 24476 22025 19357 40098 59641 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.62 5.62 0.00 0.00 1.1113 0.0000 137437
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.15% 19356.71 17198 29025 81678
crit 1.4 24.77% 40097.62 35339 59641 55760
miss 0.0 0.09% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 954 3.6% 44.8 10.08sec 9622 8545 7622 15814 24022 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.84 44.65 0.00 0.00 1.1261 0.0000 431437
Direct Results Count Pct Average Min Max Total Damage
hit 33.4 74.88% 7621.65 6621 11714 254830
crit 11.2 25.01% 15814.13 13606 24022 176607
miss 0.1 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17239 0 13274 27387 29899 28.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17239
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.73% 13274.32 10344 14551 9522
crit 0.3 28.18% 27386.52 21256 29899 7718
miss 0.0 0.09% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 11.7 27.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.70 11.70 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 11.7 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 4805 18.0% 124.0 2.69sec 17518 9962 13828 28722 45864 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.00 124.00 0.00 0.00 1.7584 0.0000 2172130
Direct Results Count Pct Average Min Max Total Damage
hit 93.0 75.01% 13828.00 12023 22320 1286160
crit 30.8 24.88% 28721.52 24705 45864 885970
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1068 4.0% 25.5 13.37sec 18946 16990 2509 5187 6805 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.48 25.48 0.00 0.00 1.1151 0.0000 80849
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 75.00% 2509.27 2313 3312 47963
crit 6.3 24.88% 5186.92 4753 6805 32887
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 889 3.3% 25.5 13.37sec 15774 0 0 0 0 25.0% 0.1% 0.0% 0.0% 111 2849 5914 25.0% 0.0% 35.2%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.48 25.48 111.16 111.16 0.0000 1.4306 401976
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 74.91% 0.00 0 0 0
crit 6.4 24.98% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 83.3 74.97% 2849.15 2489 4196 237433
crit 27.8 25.03% 5913.73 5114 8622 164542

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 101 0.4% 3.0 46.84sec 15223 13596 11742 24361 29262 27.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1197 0.0000 45670
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.27% 11741.63 9322 14240 25457
crit 0.8 27.66% 24361.25 19154 29262 20213
miss 0.0 0.07% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4113 15.4% 22.6 15.39sec 82364 72513 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6260 12952 40.1% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.57 22.57 207.85 207.85 1.1359 2.1563 1859311
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.4 59.87% 6260.10 4277 9734 779014
crit 83.4 40.13% 12952.18 8788 20003 1080297

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5127
lash_of_pain 5127 100.0% 301.2 1.51sec 7692 5110 6114 12293 18163 26.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.16 301.16 0.00 0.00 1.5051 0.0000 2316446
Direct Results Count Pct Average Min Max Total Damage
hit 218.3 72.48% 6114.00 5396 9104 1334597
crit 79.9 26.52% 12293.30 10766 18163 981850
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3555
infernal_immolation 1150 32.4% 1.0 0.00sec 58860 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2702 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 58860
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 99.02% 2701.80 2215 3830 58860
miss 0.2 0.98% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2405 67.6% 58.0 0.75sec 2122 1388 2169 4443 5478 17.4% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5284 0.0000 123078
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 44.10% 2168.63 1948 2739 55469
crit 10.1 17.37% 4443.36 3895 5478 44757
glance 14.0 24.06% 1637.56 1461 2054 22852
dodge 3.8 6.47% 0.00 0 0 0
miss 4.6 8.00% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 205
ebon_imp_melee 205 100.0% 102.7 0.78sec 793 519 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.66 102.66 0.00 0.00 1.5284 0.0000 81366
Direct Results Count Pct Average Min Max Total Damage
hit 45.8 44.64% 822.05 822 822 37673
crit 17.3 16.89% 1644.11 1644 1644 28503
glance 24.6 24.00% 616.54 617 617 15190
dodge 6.6 6.46% 0.00 0 0 0
miss 8.2 8.02% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Affliction_T11_372
bane_of_doom mana 3.7% 44.8 3082
corruption mana 0.2% 1367.9 1233
demon_soul mana 1.6% 0.0 3082
drain_soul mana 6.0% 40.0 2877
fel_flame mana 1.1% 19.9 1233
haunt mana 17.6% 3.9 2466
infernal mana 2.6% 0.0 16442
shadow_bolt mana 34.4% 10.0 1746
shadowflame mana 20.8% 3.7 5138
soul_fire mana 0.9% 8.2 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 11.1% 26.7 3082
pet - succubus
lash_of_pain mana 100.0% 13.4 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29434.5 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 11.7 377907.4 32289.8 0.0%
mp5_regen mana 1809.6 92714.0 51.2 0.2%
replenishment mana 1809.6 52378.8 28.9 0.2%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_spring_totem mana 1809.6 8916.7 4.9 69.8%
mp5_regen mana 1809.6 154343.9 85.3 61.5%
replenishment mana 1809.6 8888.3 4.9 69.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.4sec 106.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.9sec 120.9sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 180.3 0.0 2.5sec 2.5sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 3.3 0.0 121.6sec 121.6sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.4 43.2 218.1sec 10.1sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 47.9sec 47.9sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.1 167.4 390.8sec 2.6sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 15.2 1.5 28.2sec 25.7sec 12% 10%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.9sec 46.9sec 0% 60%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.5sec 79.0sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.6sec
shadow_trance 16.7 25.7sec

Statistics & Data Analysis

DPS
Population
Convergence 68.53%
σ of the average dps 5.2042
2 * σ / μ 0.0390%
95% Confidence Intervall ( μ ± 2σ ) ( 26692.99 - 26713.80 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26687.78 - 26719.01 )
Sample Data
σ 520.4158
Minimum 24895.30
Maximum 28911.90
Spread ( max - min ) 4016.61
Range ( max - min ) / 2 2008.30
Range% 7.52
10th Percentile 25944.38
90th Percentile 27229.96
( 90th Percentile - 10th Percentile ) 1285.58
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1519
0.1 scale factor error with delta=300 2407
0.05 scale factor error with delta=300 9629
0.01 scale factor error with delta=300 240740
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G life_tap,mana_percentage<=35
H soulburn
I soul_fire,if=buff.soulburn.up
J demon_soul
K shadow_bolt
L life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
M fel_flame,moving=1
N life_tap

Sample Sequence

012346789ABDFHIJKKKKB9KKFKKBKKKK9KFBGKKKKKBK9FKKBCGHIKCFKBAKK9KKBFKKKK9BKFKKGKBCCKKFKHIBKK9GKFBKKKK96BKAFKCJKBCKKCFKBCGKKKKK9BFKKKKKBK9FGKKBKKK9FKBKAKKKKBF9GKKKBKKCFKCBKKCKKBFK9GKKBKKF9KB6KKAGKBF9JKKKBKKF9KBKKKKBF9GKKKBKFK9KBKKKFAB9GKKKKBFK9KKBKKFGK9BKKKKFBK9KKKBKFK6K9KABGKKFJKKB9KKKFBGKK9KKBFKKKKB9EBEABE7EBEBEBEBE6BEAEBEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 7977 6289 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 149490 125956 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 1
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 0
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Affliction_T11_372
origin="http://chardev.org/?profile=36750"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/life_tap,mana_percentage<=35
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Demonology_T11_372 : 27024dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27024.4 13.28 / 0.05% 16.6 1624.0 1546.3 mana 0.00% 42.7
Origin http://chardev.org/?profile=36757
Talents http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • immolate
  • lash_of_pain
  • metamorphosis

Charts

http://8.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:83276|69438|31459|23664|20822|16670|13378|12140|10184|7035|1330|512&chds=0,166553&chco=9482C9,C41F3B,9482C9,435133,9482C9,435133,C41F3B,C41F3B,9482C9,9482C9,C79C6E,C79C6E&chm=t++83276++bane_of_doom,9482C9,0,0,15|t++69438++immolation_aura,C41F3B,1,0,15|t++31459++corruption,9482C9,2,0,15|t++23664++fel_flame,435133,3,0,15|t++20822++shadowflame,9482C9,4,0,15|t++16670++hand_of_guldan,435133,5,0,15|t++13378++incinerate,C41F3B,6,0,15|t++12140++soul_fire,C41F3B,7,0,15|t++10184++shadow_bolt,9482C9,8,0,15|t++7035++lash_of_pain,9482C9,9,0,15|t++1330++infernal_melee,C79C6E,10,0,15|t++512++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_Demonology_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:26,17,11,7,7,6,6,6,4,3,2,2,1,1,1,0,0&chds=0,100&chco=9482C9,9482C9,C41F3B,9482C9,C41F3B,9482C9,435133,C41F3B,C41F3B,C41F3B,435133,C79C6E,C79C6E,9482C9,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|immolate|corruption|soul_fire|bane_of_doom|hand_of_guldan|shadowflame_dot|incinerate|immolation_aura|fel_flame|ebon_imp_melee|infernal_melee|shadowflame|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Demonology_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77766662zyzzzzzzzxyyyyyyyyyyywwwwwwwwwwwwxvvvvvwwxyxyzzzzzz00zzzzzzzzzzyyyyyyyyyyxxxwwwwwwwwvvvvvvuvvwwxxxxxwxwwwwwwwwxxwwvuvvvvuuuuuuuuutttttuuuvvvvvvwwxxxxxxxxxxxxwwwwwwwwwwwwvvvvvuuuuuutuuuuvvwwwwwwwwwwwwwwwwwwwwwwvvwwwwwwwwwwwvvvwwwwxxyyyyyxxxyyyxxxxxxwwwwvwwvwwvvvvvvvvuuvvvvvuvvvvvvwwwxwxxxxxxwwwwwwvvvvvvvvvvvvvvuuuuuuuuvvvvvvvvvwwwwwwwwwwwwwvvvvvvvvvuvuuuuutttttttssssssssttttttttttttttssssssssssssrsrrrrrrqqrqqqqqqqqqqqqqqqqqqqqqqqqqpqpqqpppp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=104759&chtt=Warlock_Demonology_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ssuwwy1113245677745122200zwutspnmnmlmlmlljihhfffeeefggggfeddddddcbcccbbbZYYYYYYYYZZZZZZZYZaabbbcefffggffffffggghhhhggfeeeeddddddeeedcbbbbbbccbdddddccbbbbbbaabcbbaaZYYYYYYYYZaaaaZZYYYZZaaabbccddcccccddddddeeddddcccccdcdddddddddccddddddeddddccccccccbccccccbaaaaaaaaaaaaaaaaZZZaZaaabccdddcccddddcddddddccbbbbbaabbbbccbbbcccddddeefggggfffffffffffffeeddccbbbbbbccbbbaaaaaaaabbccddddcdddddeeeeeeeedddccccbccccccccbbbbbcccddeefffeeeeeeffgghhhgggfeeefeeffffgff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27024|max=53159&chxp=1,1,51,100&chtt=Warlock_Demonology_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,6,7,12,22,49,59,106,150,185,286,318,411,499,577,629,647,684,678,638,611,569,529,459,392,333,293,243,160,115,93,67,45,37,33,20,10,12,3,4,1,2,1,1,0,0,0,0,1&chds=0,684&chbh=5&chxt=x&chxl=0:|min=24838|avg=27024|max=29364&chxp=0,1,48,100&chtt=Warlock_Demonology_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Demonology_T11_372 27024
bane_of_doom 1653 6.1% 7.7 60.78sec 97315 83276 0 0 0 0.0% 0.1% 0.0% 0.0% 29 20219 41778 25.0% 0.0% 96.8%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 29.19 29.19 1.1686 15.0000 747464
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.9 75.03% 20219.12 14595 33459 442890
crit 7.3 24.97% 41778.05 29990 68754 304575

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 1958 7.2% 24.2 18.68sec 36559 31459 0 0 0 0.0% 0.1% 0.0% 0.0% 197 3540 7359 25.1% 0.0% 99.0%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.22 24.22 196.74 196.74 1.1621 2.2754 885320
Direct Results Count Pct Average Min Max Total Damage
hit 24.2 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.3 74.86% 3540.13 2574 6407 521421
crit 49.5 25.14% 7358.79 5289 13165 363899

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 97 0.4% 10.1 46.63sec 4332 0 3772 5850 8485 27.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.15 10.15 0.00 0.00 0.0000 0.0000 43968
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.71% 3772.26 3052 5492 27837
crit 2.8 27.17% 5849.95 4715 8485 16131
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 474 1.8% 7.8 35.72sec 27636 23664 21836 45306 82686 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.76 7.74 0.00 0.00 1.1679 0.0000 214339
Direct Results Count Pct Average Min Max Total Damage
hit 5.8 74.83% 21835.83 16138 40239 126464
crit 1.9 25.06% 45305.63 33162 82686 87875
miss 0.0 0.10% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
hand_of_guldan 1638 6.1% 31.3 14.50sec 23683 16670 18675 38809 69296 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.28 31.27 0.00 0.00 1.4207 0.0000 740827
Direct Results Count Pct Average Min Max Total Damage
hit 23.4 74.85% 18674.77 13933 33723 437029
crit 7.8 25.04% 38808.64 28630 69296 303798
miss 0.0 0.11% 0.00 0 0 0

Action details: hand_of_guldan

Static Values
  • id:71521
  • school:shadowflame
  • resource:mana
  • tree:demonology
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a falling meteor down upon the enemy target, dealing $71521s1 Shadow damage and erupts an aura of magic within $86000a1 yards, causing all targets within it to have a $86000s1% increased chance to be critically hit by any Warlock demons. The aura lasts for $86041d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.968000
  • base_dd_min:1405.76
  • base_dd_max:1660.24
immolate 2860 10.6% 1.0 236.58sec 1252083 1238116 8489 17559 20409 28.3% 0.1% 0.0% 0.0% 196 5151 10711 25.1% 0.0% 99.1%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 195.75 195.75 1.0113 2.2891 1293152
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.53% 8489.03 4297 9932 6272
crit 0.3 28.34% 17559.12 8830 20409 5140
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 146.6 74.87% 5150.97 3781 8907 754970
crit 49.2 25.13% 10710.51 7769 18302 526771

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
immolation_aura 744 2.8% 5.0 95.46sec 67513 69438 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3382 0 0.0% 0.1% 0.0%

Stats details: immolation_aura

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.99 4.99 0.00 99.63 0.9723 0.0000 336587
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 99.5 99.89% 3381.87 2914 4272 336587
miss 0.1 0.11% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:50590
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites the area surrounds you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.100000
  • base_dd_min:566.82
  • base_dd_max:566.82

Action details: immolation_aura

Static Values
  • id:50589
  • school:fire
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:13153.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damaging all nearby enemies.
  • description:Ignites the area surrounding you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 1172 4.3% 31.7 12.36sec 16719 13378 13242 27474 49892 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.70 31.55 0.00 0.00 1.2497 0.0000 529964
Direct Results Count Pct Average Min Max Total Damage
hit 23.6 74.78% 13241.57 8381 24280 312411
crit 7.9 25.10% 27474.43 17222 49892 217554
miss 0.0 0.12% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 72 0.3% 1.0 0.00sec 32478 0 24836 51014 51815 29.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 32478
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 70.67% 24835.89 17926 25216 17552
crit 0.3 29.26% 51013.92 42148 51815 14927
miss 0.0 0.07% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
metamorphosis 0 0.0% 5.0 95.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.99 4.99 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0

Action details: metamorphosis

Static Values
  • id:47241
  • school:physical
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • description:You transform into a Demon for $47241d. This form increases your armor contribution from items by $47241s2%, damage by $47241s3%, reduces the chance you'll be critically hit by melee attacks by $54879s1% and reduces the duration of stun and snare effects by $54817s1%. You gain some unique demon abilities in addition to your normal abilities.
shadow_bolt 4570 16.9% 104.6 3.20sec 19751 10184 15580 32400 63585 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
104.64 104.64 0.00 0.00 1.9394 0.0000 2066733
Direct Results Count Pct Average Min Max Total Damage
hit 78.5 74.98% 15579.66 11282 30944 1222394
crit 26.1 24.90% 32399.81 23183 63585 844339
miss 0.1 0.12% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1860 6.9% 34.5 13.17sec 24345 20822 2822 5837 9435 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.55 34.55 0.00 0.00 1.1692 0.0000 123370
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.92% 2822.08 2171 4592 73038
crit 8.6 24.96% 5836.68 4461 9435 50333
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1587 5.9% 34.5 13.17sec 20774 0 0 0 0 25.0% 0.1% 0.0% 0.0% 140 4039 8395 25.1% 0.0% 47.4%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.55 34.55 139.80 139.80 0.0000 1.5334 717624
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.86% 0.00 0 0 0
crit 8.6 25.04% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.7 74.88% 4038.90 2919 7272 422793
crit 35.1 25.12% 8394.60 5998 14942 294830

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1864 6.9% 48.4 9.38sec 17406 12140 13897 28809 50710 25.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.43 47.65 0.00 0.00 1.4337 0.0000 842892
Direct Results Count Pct Average Min Max Total Damage
hit 35.4 74.33% 13896.72 10934 24678 492152
crit 12.2 25.55% 28808.67 22468 50710 350740
miss 0.1 0.12% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - succubus 7058
lash_of_pain 7058 100.0% 301.2 1.51sec 10588 7035 7819 15694 23202 36.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.16 301.16 0.00 0.00 1.5051 0.0000 3188589
Direct Results Count Pct Average Min Max Total Damage
hit 189.3 62.85% 7819.38 6893 11630 1480138
crit 108.9 36.15% 15693.78 13752 23202 1708450
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3440
infernal_immolation 1101 32.0% 1.0 0.00sec 81289 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2565 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 32.00 0.0000 0.0000 81289
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.7 99.02% 2565.40 2215 3830 81289
miss 0.3 0.98% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2339 68.0% 84.0 0.76sec 2056 1330 2111 4286 5478 17.2% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
84.00 84.00 0.00 0.00 1.5458 0.0000 172703
Direct Results Count Pct Average Min Max Total Damage
hit 37.2 44.33% 2111.34 1948 2739 78620
crit 14.5 17.24% 4285.70 3895 5478 62050
glance 20.1 23.97% 1590.95 1461 2054 32033
dodge 5.5 6.50% 0.00 0 0 0
miss 6.7 7.96% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 463
ebon_imp_melee 463 100.0% 257.2 0.79sec 792 512 822 1644 1644 16.9% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
257.23 257.23 0.00 0.00 1.5458 0.0000 203766
Direct Results Count Pct Average Min Max Total Damage
hit 114.6 44.55% 822.05 822 822 94207
crit 43.4 16.88% 1644.11 1644 1644 71405
glance 61.9 24.06% 616.54 617 617 38153
dodge 16.7 6.49% 0.00 0 0 0
miss 20.6 8.01% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Demonology_T11_372
bane_of_doom mana 3.2% 31.6 3082
corruption mana 4.1% 29.7 1233
demon_soul mana 1.4% 0.0 3082
fel_flame mana 1.3% 22.4 1233
hand_of_guldan mana 6.1% 16.5 1438
immolate mana 0.2% 761.6 1644
immolation_aura mana 7.1% 6.4 10515
incinerate mana 12.4% 5.8 2877
infernal mana 2.2% 0.0 16442
shadow_bolt mana 24.9% 11.3 1746
shadowflame mana 24.2% 4.7 5138
soul_fire mana 12.2% 9.4 1849
soulburn soul_shards 100.0% 0.0 1
pet - succubus
lash_of_pain mana 100.0% 18.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29096.5 16.1 1.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 0.9 24090.7 28054.8 0.0%
mana_feed mana 108.9 496734.1 4563.0 2.2%
mp5_regen mana 1809.6 91664.0 50.7 1.4%
replenishment mana 1809.6 51855.2 28.7 1.3%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 0.9 84.5 98.4 99.4%
mana_spring_totem mana 1809.6 8886.0 4.9 69.9%
mp5_regen mana 1809.6 154334.1 85.3 61.6%
replenishment mana 1809.6 8844.3 4.9 69.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.6sec 104.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 215.9 0.0 2.1sec 2.1sec 77% 77%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
decimation 1.0 53.3 58.6sec 2.1sec 24% 94%

Database details

  • id:63167
  • cooldown name:buff_decimation
  • tooltip:Your Soul Fire cast time is reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
demon_soul_succubus 3.3 0.0 122.0sec 122.0sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
hand_of_guldan 8.8 22.5 49.2sec 14.5sec 97% 97%

Database details

  • id:
  • cooldown name:buff_hand_of_guldan
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
metamorphosis 5.0 0.0 95.5sec 95.5sec 39% 68%

Database details

  • id:47241
  • cooldown name:buff_metamorphosis
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • max_stacks:1
  • duration:36.00
  • cooldown:0.00
  • default_chance:100.00%
molten_core 10.2 1.6 41.2sec 35.3sec 16% 100%

Database details

  • id:71165
  • cooldown name:buff_molten_core
  • tooltip:Increases damage done by $71165s1% and reduces cast time by $71165s3% of your Incinerate.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:6.00%
power_torrent_mh 9.9 0.0 47.9sec 47.9sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 46.6sec 46.6sec 0% 6%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.9 0.1 83.0sec 81.5sec 2% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.2sec 363.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 14.6 29.4sec
impending_doom 25.1 16.2sec

Statistics & Data Analysis

DPS
Population
Convergence 56.18%
σ of the average dps 6.6419
2 * σ / μ 0.0492%
95% Confidence Intervall ( μ ± 2σ ) ( 27011.09 - 27037.66 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27004.45 - 27044.30 )
Sample Data
σ 664.1936
Minimum 24838.27
Maximum 29363.76
Spread ( max - min ) 4525.49
Range ( max - min ) / 2 2262.75
Range% 8.37
10th Percentile 25957.51
90th Percentile 27320.30
( 90th Percentile - 10th Percentile ) 1362.79
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2416
0.1 scale factor error with delta=300 3921
0.05 scale factor error with delta=300 15685
0.01 scale factor error with delta=300 392136
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 metamorphosis
9 immolation,if=buff.metamorphosis.remains>10
A bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
B immolate,if=!ticking&target.time_to_die>=4&miss_react
C corruption,if=(remains<tick_time|!ticking)&target.time_to_die>=6&miss_react
D fel_flame,if=buff.tier11_4pc_caster.react
E shadowflame
F hand_of_guldan
G incinerate,if=buff.molten_core.react
H soulburn
I soul_fire,if=buff.decimation.react|buff.soulburn.up
J summon_infernal
K life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
L demon_soul
M shadow_bolt
N life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
O fel_flame,moving=1
P life_tap

Sample Sequence

012346789ABCEFGGGHIJLMMMMEFCMGGGMMGGEGFMMMCMMEMFMMMMECHIMFAMMEMMMCFMMEMMMGFGGCEGGGMMFHIMEMCMMMFM689ADDEMMCFLMMMEMMMFCMGEGGMGGFGKEMCMDDMFEMMMAMCMEFMMMMMEMCFMMMMEDDMFC89MMEMMDDFGG6GCAEMMMFLMGGEGMCMFMMEMMMMCFMEMMMMMFECMMAMMMEFM89CMMMEMFMMGGGCEMFMMMMEMMCFGGG6GEAMMMFMCELMMMMFMEM89CMMMFEMMMIICIEFIIIIIAIEIFC7IIIIIEIIFIIICIEIIIFIIIIEIICGFGGGGEII6IIAFCIEIIIIIIFGEG89CGIIIIFEIGGGICDDIEFIGDDGGII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8438 6652 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 155860 131038 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 27.20% 17.62% 2256
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 17.62% 17.62% 2256
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.87% 13.87% 1053

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 0
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 3
Dark Arts 3
Fel Synergy 2
Demonic Rebirth 2
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 3
Demonic Empowerment 1
Improved Health Funnel 0
Molten Core 3
Hand of Gul'dan 1
Aura of Foreboding 2
Ancient Grimoire 2
Inferno 1
Decimation 2
Cremation 2
Demonic Pact 1
Metamorphosis 1
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Demonology_T11_372
origin="http://chardev.org/?profile=36757"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
glyphs=life_tap/shadow_bolt/immolate/lash_of_pain/metamorphosis
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/metamorphosis
actions+=/immolation,if=buff.metamorphosis.remains>10
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/immolate,if=!ticking&target.time_to_die>=4&miss_react
actions+=/corruption,if=(remains=6&miss_react
actions+=/fel_flame,if=buff.tier11_4pc_caster.react
actions+=/shadowflame
actions+=/hand_of_guldan
actions+=/incinerate,if=buff.molten_core.react
actions+=/soulburn
actions+=/soul_fire,if=buff.decimation.react|buff.soulburn.up
actions+=/summon_infernal
actions+=/life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2256
# gear_mastery_rating=1053
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Destruction_T11_372 : 27663dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27663.1 9.51 / 0.03% 13.1 2116.9 2001.3 mana 0.00% 49.0
Origin http://chardev.org/?profile=36761
Talents http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
Glyphs
  • life_tap
  • immolate
  • imp
  • conflagrate

Charts

http://9.chart.apis.google.com/chart?chs=550x420&cht=bhg&chf=bg,s,333333&chd=t:63665|55179|27701|26927|26373|22278|17068|16066|13448|10850|4691|1385|524&chds=0,127330&chco=9482C9,C41F3B,C41F3B,435133,9482C9,9482C9,C41F3B,9482C9,C41F3B,C41F3B,C41F3B,C79C6E,C79C6E&chm=t++63665++bane_of_doom,9482C9,0,0,15|t++55179++immolate,C41F3B,1,0,15|t++27701++conflagrate,C41F3B,2,0,15|t++26927++fel_flame,435133,3,0,15|t++26373++corruption,9482C9,4,0,15|t++22278++shadowflame,9482C9,5,0,15|t++17068++chaos_bolt,C41F3B,6,0,15|t++16066++shadowburn,9482C9,7,0,15|t++13448++incinerate,C41F3B,8,0,15|t++10850++soul_fire,C41F3B,9,0,15|t++4691++firebolt,C41F3B,10,0,15|t++1385++infernal_melee,C79C6E,11,0,15|t++524++ebon_imp_melee,C79C6E,12,0,15&chtt=Warlock_Destruction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,17,14,13,7,6,6,5,5,4,2,1,1,1,1,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,9482C9,C41F3B,C41F3B,9482C9,435133,C79C6E,9482C9,9482C9,C79C6E,C41F3B,C41F3B,C41F3B&chl=firebolt|incinerate|immolate|conflagrate|soul_fire|shadowflame_dot|corruption|burning_embers|chaos_bolt|bane_of_doom|fel_flame|infernal_melee|shadowburn|shadowflame|ebon_imp_melee|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Destruction_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s8644333xyzy000zzywwuuvvwwxxvvtssrqqpppqqqstrqqppppprrrrsrrrrrrqppqqrrrppoooooooooooonmnoonnnnnnnnmnnnoooooooonnnnnnnnnnnmlkkjiihihhijjkjjjjiihhhhijjjjjjjjjjjjjiiiiiihhhggggggggggffffeeeddddddeeeeefffffeeeddddddddddddcccbbbbbbbbbbbbaaaaaaaaaaaZZZZZZZYYYYYYYYYXXXXXXXXXWXXWWWWWVVVVVVVVWWWXXXXXXXWWWWWWWWWWWWWVVVVVVUUUUUUUUUVVVVVVVVVVWWWWWWXXXXXXXXXXXXXWWWWWWWWWWWWVVVUUUUUTTTUUUVVWWWWXWWWWWWWWWWWWWWWWWWWWWVVVVVVVVVVWWWWWWXXXXXXYYYYYYYYYZZZZZZZYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105785&chtt=Warlock_Destruction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fmnnoqstvyx1212456875411100zyvrrqppppoonnmnnmnmkkjijjkllkjjhhhhhgffeffgggfcccdeeeedddeeeffeeeefghhhhiiiiiiiiiiiijjklkkjiiiijjjjiijjklkkjiiijjjjjjjjkjjjiihhhgggggggffeeeeddddddeeeeedddddeeefffgghhhgfffgggghhhhhhhhggggggghhiiiiiiiiiiiiiiijkkkkjjjjjjjjjjiiiiiihhgggggffffffffeeeeefffgghhhhhhhhhggggggggggffeeeedddeeeffgghhhhiijjkkklllmmmlllkkkjjjjiihhgggfffeefffggggggggghhiijjkklllkkkjjjjjjjiiihhhggfffeeeefffgggggghhhiijjkklllllllllllkkkkkjjiiihihhhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27663|max=47725&chxp=1,1,58,100&chtt=Warlock_Destruction_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,5,6,8,19,22,33,62,87,134,160,184,277,350,425,486,593,609,653,664,653,614,615,511,477,437,417,303,304,215,158,121,106,85,63,38,36,16,22,8,6,4,4,1,3,0,0,1,1&chds=0,664&chbh=5&chxt=x&chxl=0:|min=25934|avg=27663|max=29627&chxp=0,1,47,100&chtt=Warlock_Destruction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Destruction_T11_372 27663
bane_of_doom 1237 4.5% 7.7 60.09sec 72473 63665 0 0 0 0.0% 1.5% 0.0% 0.0% 29 15237 31558 25.1% 0.0% 95.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.72 7.72 28.93 28.93 1.1383 15.0000 559474
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.50% 0.00 0 0 0
miss 0.1 1.50% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.7 74.86% 15237.06 12416 20783 329946
crit 7.3 25.14% 31558.00 25514 42705 229528

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
burning_embers 1399 5.1% 330.9 1.36sec 1913 0 0 0 0 24.6% 1.5% 0.0% 0.0% 448 1413 0 0.0% 0.0% 99.1%

Stats details: burning_embers

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
330.94 330.94 448.03 448.03 0.0000 1.0000 632938
Direct Results Count Pct Average Min Max Total Damage
hit 244.4 73.85% 0.00 0 0 0
crit 81.5 24.62% 0.00 0 0 0
miss 5.1 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 448.0 100.00% 1412.71 214 2158 632938

Action details: burning_embers

Static Values
  • id:85421
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:Your Soulfire and your Imp's Firebolt cause a Burning Ember damage-over-time effect on the target equal to a percentage of the damage done lasting $85421d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1244.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
chaos_bolt 1375 5.0% 31.1 14.57sec 20000 17068 15314 32136 45463 29.8% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.09 30.94 0.00 0.00 1.1717 0.0000 621805
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 68.69% 15314.34 12724 21370 325523
crit 9.2 29.80% 32136.12 26360 45463 296282
miss 0.5 1.51% 0.00 0 0 0

Action details: chaos_bolt

Static Values
  • id:50796
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a bolt of chaotic fire at the enemy, dealing $s1 Fire damage. Chaos Bolt cannot be resisted, and pierces through all absorption effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1311.57
  • base_dd_max:1665.89
conflagrate 3636 13.1% 51.9 8.76sec 31692 27701 22599 46543 75123 39.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.90 51.90 0.00 0.00 1.1441 0.0000 1644796
Direct Results Count Pct Average Min Max Total Damage
hit 30.7 59.09% 22598.68 18565 36559 693014
crit 20.4 39.40% 46543.27 38149 75123 951782
miss 0.8 1.51% 0.00 0 0 0

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3288.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly deals fire damage equal to $s2% of your Immolate's periodic damage on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:10958.91
  • base_dd_max:10958.91
corruption 1678 6.1% 25.2 18.12sec 30096 26373 0 0 0 0.0% 1.5% 0.0% 0.0% 199 2999 6220 25.0% 0.0% 98.3%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.22 25.22 199.43 199.43 1.1411 2.2299 758941
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 98.50% 0.00 0 0 0
miss 0.4 1.50% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 149.5 74.96% 2999.21 2430 4426 448357
crit 49.9 25.04% 6219.89 4994 9094 310584

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 109 0.4% 10.3 45.96sec 4796 0 4244 6562 7760 26.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.27 10.27 0.00 0.00 0.0000 0.0000 49248
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 71.90% 4243.91 3817 5023 31331
crit 2.7 26.59% 6562.06 5898 7760 17916
miss 0.2 1.51% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 508 1.8% 7.5 37.56sec 30776 26927 24680 51230 75581 24.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.46 7.44 0.00 0.00 1.1429 0.0000 229697
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 73.90% 24680.23 20162 36782 135783
crit 1.8 24.63% 51229.56 41429 75581 93914
miss 0.1 1.47% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
immolate 3835 13.9% 26.9 16.96sec 64607 55179 6371 13328 18658 30.6% 1.5% 0.0% 0.0% 200 5637 11832 31.1% 0.0% 98.8%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.85 26.85 199.51 199.51 1.1709 2.2404 1734812
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 67.95% 6371.35 5371 9080 116255
crit 8.2 30.55% 13327.63 11036 18658 109341
miss 0.4 1.49% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 137.4 68.89% 5637.25 4725 8142 774810
crit 62.1 31.11% 11831.99 9709 16731 734406

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 4636 16.8% 119.8 3.69sec 17500 13448 13378 28319 40968 29.5% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
119.83 119.29 0.00 0.00 1.3013 0.0000 2096992
Direct Results Count Pct Average Min Max Total Damage
hit 82.3 68.99% 13377.85 11100 19937 1101001
crit 35.2 29.48% 28318.85 21171 40968 995991
miss 1.8 1.53% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 60 0.2% 1.0 0.00sec 27005 0 20918 43016 43854 28.9% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 27005
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 69.73% 20917.87 15164 23049 14586
crit 0.3 28.87% 43016.04 32717 43854 12419
miss 0.0 1.40% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
shadowburn 222 0.8% 5.4 17.50sec 18650 16066 14851 30825 42940 25.1% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.39 5.39 0.00 0.00 1.1608 0.0000 100457
Direct Results Count Pct Average Min Max Total Damage
hit 4.0 73.42% 14851.39 11833 20897 58733
crit 1.4 25.13% 30824.77 24316 42940 41724
miss 0.1 1.45% 0.00 0 0 0

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly blasts the target for $17877s2 Shadow damage. If the target dies within $29341d of Shadowburn, and yields experience or honor, the caster gains $29341s1 Soul Shards. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.056000
  • base_dd_min:649.32
  • base_dd_max:724.90
shadowflame 1900 6.9% 33.7 13.48sec 25512 22278 2163 4468 5874 24.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.68 33.68 0.00 0.00 1.1452 0.0000 90795
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.92% 2162.70 1848 2858 53838
crit 8.3 24.56% 4468.38 3797 5874 36956
miss 0.5 1.53% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1699 6.1% 33.7 13.48sec 22816 0 0 0 0 24.7% 1.5% 0.0% 0.0% 134 4502 9338 25.1% 0.0% 44.6%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.68 33.68 134.44 134.44 0.0000 1.4989 768410
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.81% 0.00 0 0 0
crit 8.3 24.66% 0.00 0 0 0
miss 0.5 1.52% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.7 74.90% 4501.62 3647 6647 453261
crit 33.8 25.10% 9337.65 7494 13658 315149

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1808 6.5% 39.1 11.44sec 20886 10850 16017 33518 46363 29.7% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.15 38.99 0.00 0.00 1.9251 0.0000 817626
Direct Results Count Pct Average Min Max Total Damage
hit 26.8 68.72% 16016.84 13668 22563 429178
crit 11.6 29.72% 33517.51 28085 46363 388448
miss 0.6 1.56% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 45.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - imp 4688
firebolt 4688 100.0% 300.2 1.51sec 7061 4691 5697 11477 17135 26.2% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
300.19 298.54 0.00 0.00 1.5051 0.0000 2119589
Direct Results Count Pct Average Min Max Total Damage
hit 214.2 71.75% 5696.98 4983 8589 1220314
crit 78.4 26.25% 11477.08 9942 17135 899274
miss 6.0 2.00% 0.00 0 0 0

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:632.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $ Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.649000
  • base_dd_min:111.86
  • base_dd_max:124.88
pet - infernal 3350
infernal_immolation 1068 31.9% 1.0 0.00sec 56848 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2638 0 0.0% 2.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 56848
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.5 97.95% 2638.00 2209 3825 56848
miss 0.5 2.05% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2282 68.1% 58.0 0.74sec 2094 1385 2146 4383 5472 17.2% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5120 0.0000 121440
Direct Results Count Pct Average Min Max Total Damage
hit 25.7 44.27% 2146.18 1945 2736 55113
crit 10.0 17.23% 4382.74 3890 5472 43806
glance 13.9 23.98% 1619.25 1459 2052 22521
dodge 3.8 6.52% 0.00 0 0 0
miss 4.6 7.99% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 205
ebon_imp_melee 205 100.0% 102.7 0.77sec 792 524 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.70 102.70 0.00 0.00 1.5120 0.0000 81341
Direct Results Count Pct Average Min Max Total Damage
hit 45.8 44.58% 822.05 822 822 37638
crit 17.3 16.88% 1644.11 1644 1644 28504
glance 24.7 24.00% 616.54 617 617 15199
dodge 6.7 6.50% 0.00 0 0 0
miss 8.2 8.03% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Destruction_T11_372
bane_of_doom mana 2.5% 23.5 3082
chaos_bolt mana 4.7% 13.9 1438
conflagrate mana 17.8% 9.6 3288
corruption mana 3.2% 24.4 1233
demon_soul mana 1.1% 0.0 2368
fel_flame mana 1.0% 25.0 1233
immolate mana 4.6% 39.3 1644
incinerate mana 36.0% 6.1 2877
infernal mana 1.7% 0.0 16442
shadowburn mana 1.7% 6.1 3082
shadowflame mana 18.1% 5.0 5138
soul_fire mana 7.6% 11.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - imp
firebolt mana 100.0% 11.2 632
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29400.2 16.2 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 99788.0 99788.0 0.0%
life_tap mana 0.6 16883.9 27480.2 0.0%
mana_feed mana 78.4 364504.7 4652.0 0.2%
mp5_regen mana 1809.6 92607.9 51.2 0.3%
replenishment mana 1809.6 52255.4 28.9 0.3%
soul_leech mana 74.2 343707.2 4634.1 0.2%
pet - imp mana
initial_mana none 1.0 74772.5 74772.5 0.0%
mana_feed mana 0.6 69.0 112.4 99.3%
mana_spring_totem mana 1809.6 8156.5 4.5 72.4%
mp5_regen mana 1809.6 171593.0 94.8 65.7%
replenishment mana 1809.6 9790.3 5.4 72.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 33.7 17.4 13.5sec 8.9sec 81% 84%

Database details

  • id:54277
  • cooldown name:buff_backdraft
  • tooltip:Reduced cast time for your Shadow Bolt, Incinerate and Chaos Bolt by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bell_of_enraging_resonance 4.8 0.0 103.8sec 103.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 205.7 0.0 2.2sec 2.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.3 0.0 46.0sec 46.0sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_imp 4.3 0.0 120.7sec 120.7sec 19% 17%

Database details

  • id:79459
  • cooldown name:buff_demon_soul_imp
  • tooltip:Critical strike chance of your cast time Destruction spells increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
empowered_imp 11.4 0.4 36.1sec 34.9sec 5% 7%

Database details

  • id:47283
  • cooldown name:buff_empowered_imp
  • tooltip:Soulfire is instant cast.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:4.00%
improved_soul_fire 7.3 31.1 60.8sec 11.6sec 95% 94%

Database details

  • id:85383
  • cooldown name:buff_improved_soul_fire
  • tooltip:Shadow and Fire damage increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.6sec 46.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 45.7sec 45.7sec 0% 2%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.2 86.2sec 80.4sec 6% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.3sec 363.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
imp-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
imp-casting 301.2 0.0 1.5sec 1.5sec 95% 95%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 15.4%
backdraft_1 21.8%
backdraft_2 29.6%
backdraft_3 33.1%

Procs

Count Interval
ebon_imp 5.8 63.6sec
empowered_imp 11.7 34.9sec

Statistics & Data Analysis

DPS
Population
Convergence 67.62%
σ of the average dps 4.7530
2 * σ / μ 0.0344%
95% Confidence Intervall ( μ ± 2σ ) ( 27653.59 - 27672.61 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27648.84 - 27677.36 )
Sample Data
σ 475.2955
Minimum 25934.45
Maximum 29626.65
Spread ( max - min ) 3692.20
Range ( max - min ) / 2 1846.10
Range% 6.67
10th Percentile 26967.34
90th Percentile 28121.19
( 90th Percentile - 10th Percentile ) 1153.85
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1180
0.1 scale factor error with delta=300 2008
0.05 scale factor error with delta=300 8032
0.01 scale factor error with delta=300 200805
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_imp
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 soulburn,if=buff.bloodlust.down
A soul_fire,if=buff.soulburn.up
B fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
C immolate,if=(remains<cast_time+gcd|!ticking)&target.time_to_die>=4&miss_react
D conflagrate
E bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
F corruption,if=(!ticking|dot.corruption.remains<tick_time)&miss_react
G shadowflame
H soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
I chaos_bolt
J summon_infernal
K soulburn,if=buff.bloodlust.down
L soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
M shadowburn
N incinerate
O life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
P fel_flame,moving=1
Q life_tap

Sample Sequence

01234678CDEFGIJLBBDNNNNGNIDCFLNNNNDGNINNCLD9AFNBGHDINBNNNDFGCILDENNNNBDGBFILDNB9ABGBDNINFLDCGNNNIDNLNFGCDNNI68NNDEGLN9ACDFINNNGDHLNCIDFNGNNLDNINCGNDFHLNIDGNCNNNDEFIGLNDNCNNNLDGFHINNCDNNNGHLDFHINCNDGNNLND68INFCGEDLNNIBDNGBFLDNINCNGDNLNFIDNNCGNLDNINNFGDNCLNEDINGNNFDCLNIGDNNNNLCDCFGINNDLNNNGCDFINL68NDNGNNECDILFNGDNNNNCIDLFGNNDNNNCILDGNNFNNQDCIGLNDNNNEFFDC7GILMDNNNNGFCDHINMNNDGNLCFDINMHGNDBNB68NILDFGECMNDNILNGDFNNCMIDLGNNNDNNCFIGDLMNNNDNIGFL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5731 5049 4639
Spirit 203 203 20
Health 152668 128504 0
Mana 105638 96008 0
Spell Power 9423 7246 2207
Spell Hit 15.47% 15.47% 1585
Spell Crit 20.66% 14.61% 919
Spell Haste 30.05% 20.25% 2593
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 13.20% 13.20% 1585
Melee Crit 16.14% 8.19% 919
Melee Haste 20.25% 20.25% 2593
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.97% 12.97% 891

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 3
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 2
Backdraft 3
Shadowburn 1
Burning Embers 2
Soul Leech 2
Backlash 0
Nether Ward 1
Fire and Brimstone 3
Shadowfury 1
Nether Protection 2
Empowered Imp 2
Bane of Havoc 1
Chaos Bolt 1

Profile

#!./simc

warlock=Warlock_Destruction_T11_372
origin="http://chardev.org/?profile=36761"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
glyphs=life_tap/immolate/imp/conflagrate
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_imp
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.soulburn.up
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
actions+=/immolate,if=(remains=4&miss_react
actions+=/conflagrate
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/corruption,if=(!ticking|dot.corruption.remains actions+=/shadowflame
actions+=/soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
actions+=/chaos_bolt
actions+=/summon_infernal
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
actions+=/shadowburn
actions+=/incinerate
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4639
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1585
# gear_crit_rating=919
# gear_haste_rating=2593
# gear_mastery_rating=891
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warrior_Arms_T11_372 : 27541dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27541.5 16.15 / 0.06% 2716.2 10.1 10.2 rage 7.35% 50.3
Origin http://chardev.org/?profile=36399
Talents http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
Glyphs
  • thunder_clap
  • cleaving
  • sweeping_strikes
  • battle
  • berserker_rage
  • intimidating_shout
  • slam
  • overpower
  • mortal_strike

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31996|24895|19929|17923|16695|8908|3237&chds=0,63993&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31996++overpower,C79C6E,0,0,15|t++24895++execute,C79C6E,1,0,15|t++19929++slam,C79C6E,2,0,15|t++17923++mortal_strike,C79C6E,3,0,15|t++16695++rend,C79C6E,4,0,15|t++8908++colossus_smash,C79C6E,5,0,15|t++3237++melee_main_hand,C79C6E,6,0,15&chtt=Warrior_Arms_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:20,19,11,10,10,8,6,6,5,4&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E&chl=overpower|mortal_strike|slam_mh|melee_main_hand|opportunity_strike|deep_wounds|execute|rend_dot|heroic_strike|colossus_smash&chtt=Warrior_Arms_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bgbhbhlq4357775uqjlifdaeecZabZWZaaaXWYZbaZbXXXTUUUTSRRSSRRSRRVVWXWXXVXXWXXWWUVUUUTTTSTSSTSSTTTUSSSRRRRRRRRRSRRRQQRPQQPQRQRTUUVXZdgjnrtwxuspljhfedbaaZYYYXYYXXXVWVVVUUVUUUUUUTTTTSSTSSSSTUTUUTTTSSSSRSSSSSRRSRSSRRSRSSSTUUUUUTTTTTTTTUSTUTTTTTTTTTTSTTUVWXZbdfhjlmmmlkjhgfedcbaZYXXXXXXXWWVVVVUVUUUUUUUTUUTUUTTTTTUUVWWWXXWWVUUUTTTSSSRSSSSSSSSRSSTTTTSSSSTSSTTSTSSTTSTTTTTTTTTTUUUVVWWXXYZZaaaaaZZZYYYYYXXXXWWXXXWWWWVVVVUUUUUUTTTTTTTTTTTTTTTUTTTTTTTTTTTTTTTTTTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Warrior_Arms_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:344455765446677785124zxwwvurqrrrqqpqpooonmlllkkjjjjihgggfffeeeefffffffffffffffefffffffffffeeeffffffgggfffgggggghhhiijjkkkkkllmmmnnnoonnnnnmmmmmmmmlllllllkkkkkkkkkkkjjjiihhhgggggggffffffffffffffffffffffeeeffffffggggghhhhhhhiiiiiiiiiiiihiiiiiiiiijjjjjjjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkjjjjjiiiiiihhhhhhhhhhiiiiiijjjjjjjjkkkkkkkkkllllllllllllllllllllllllkkkkkkkkkkkkkkkllllllllllmmmmmmnnnnoooppppqqqrrrsssssssssrrrrrqqqqqqqqpppqqqqqqrrrrrrrrrrrrrrrrrrrr&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27541|max=44214&chxp=1,1,62,100&chtt=Warrior_Arms_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,3,6,11,20,31,47,72,106,158,235,306,367,438,530,592,668,678,711,736,714,623,547,521,431,379,283,211,187,124,80,65,50,20,19,14,7,3,4,0,0,0,0,0,0,0,0,0,1&chds=0,736&chbh=5&chxt=x&chxl=0:|min=24629|avg=27541|max=31917&chxp=0,1,40,100&chtt=Warrior_Arms_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Arms_T11_372 27541
battle_shout 0 0.0% 5.5 76.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.48 5.48 0.00 0.00 1.5144 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 15.2 30.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.17 15.17 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
colossus_smash 1102 4.0% 37.0 12.27sec 13483 8908 11217 23623 42053 21.2% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.98 36.98 0.00 0.00 1.5135 0.0000 498571
Direct Results Count Pct Average Min Max Total Damage
hit 27.9 75.47% 11216.63 8858 19884 313046
crit 7.9 21.24% 23622.57 18248 42053 185525
dodge 1.2 3.29% 0.00 0 0 0

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
deadly_calm 0 0.0% 3.5 128.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.52 3.52 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:-0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Abilities cost no rage.
  • description:For the next $d, none of your abilities cost rage, but you continue to generate rage. Cannot be used during Inner Rage.
deep_wounds 2263 8.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 430 2377 0 0.0% 0.0% 95.2%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 173.47 430.40 430.40 0.0000 1.0000 1023213
Direct Results Count Pct Average Min Max Total Damage
hit 173.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 430.4 100.00% 2377.37 755 10276 1023213

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1604.99
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1691 6.1% 20.3 4.36sec 37622 24895 31237 57866 135706 27.9% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.32 20.32 0.00 0.00 1.5112 0.0000 764669
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 68.83% 31237.27 20 65877 436969
crit 5.7 27.86% 57865.92 704 135706 327701
dodge 0.7 3.31% 0.00 0 0 0

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 1496 5.4% 39.2 11.35sec 17272 0 12611 27328 47786 34.5% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.17 39.17 0.00 0.00 0.0000 0.0000 676575
Direct Results Count Pct Average Min Max Total Damage
hit 24.4 62.21% 12610.65 8205 23197 307296
crit 13.5 34.50% 27327.88 16903 47786 369279
dodge 1.3 3.29% 0.00 0 0 0

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 2788 10.1% 128.7 3.53sec 9798 3237 8879 18304 29783 18.5% 3.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
128.69 128.69 0.00 0.00 3.0271 0.0000 1260946
Direct Results Count Pct Average Min Max Total Damage
hit 69.6 54.10% 8878.66 6278 14458 618138
crit 23.9 18.55% 18304.12 12933 29783 436914
glance 30.9 24.02% 6660.95 4709 10843 205894
dodge 4.3 3.33% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 5306 19.3% 88.0 5.15sec 27259 17923 20125 45794 74735 30.4% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.04 88.04 0.00 0.00 1.5209 0.0000 2399839
Direct Results Count Pct Average Min Max Total Damage
hit 58.3 66.27% 20125.32 12083 32894 1174115
crit 26.8 30.40% 45793.55 27454 74735 1225724
dodge 2.9 3.33% 0.00 0 0 0

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:Healing effects received reduced by $s1%.
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and wounds the target, reducing the effectiveness of any healing received by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:423.09
  • base_dd_max:423.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
opportunity_strike 2707 9.8% 127.5 3.53sec 9599 0 8013 16855 27651 21.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.54 127.54 0.00 0.00 0.0000 0.0000 1224291
Direct Results Count Pct Average Min Max Total Damage
hit 96.5 75.69% 8012.93 5790 13078 773501
crit 26.7 20.97% 16855.38 11928 27651 450791
dodge 4.3 3.35% 0.00 0 0 0

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
overpower 5527 20.1% 77.1 5.81sec 32431 31996 16044 36758 58727 79.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.07 77.07 0.00 0.00 1.0136 0.0000 2499531
Direct Results Count Pct Average Min Max Total Damage
hit 16.1 20.89% 16043.57 8787 25848 258271
crit 61.0 79.11% 36758.06 19732 58727 2241260

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:5.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly overpower the enemy, causing $m1% weapon damage. Only useable after the target dodges. The Overpower cannot be blocked, dodged or parried.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
recklessness 0 0.0% 2.0 363.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
rend 1649 6.0% 29.4 15.45sec 25328 16695 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.45 29.45 0.00 0.00 1.5171 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 29.4 100.00% 0.00 0 0 0

Action details: rend

Static Values
  • id:772
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Wounds the target causing them to bleed for $94009o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $94009d.
rend_dot 1649 6.0% 29.4 15.45sec 25328 0 0 0 0 0.0% 3.4% 0.0% 0.0% 168 3611 7456 21.6% 0.0% 92.5%

Stats details: rend_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.45 29.45 167.92 167.92 0.0000 2.4915 745905
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 96.64% 0.00 0 0 0
dodge 1.0 3.36% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.6 78.38% 3610.92 1494 4902 475249
crit 36.3 21.62% 7455.54 3077 10099 270656

Action details: rend_dot

Static Values
  • id:94009
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:Wounds the target causing them to bleed for $o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:1767.64
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slam 3012 10.9% 45.2 7.87sec 30137 19929 0 0 0 0.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.19 45.19 0.00 0.00 1.5122 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 43.7 96.69% 0.00 0 0 0
dodge 1.5 3.31% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 3012 10.9% 43.7 8.13sec 31169 0 23823 54161 89504 24.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.70 43.70 0.00 0.00 0.0000 0.0000 1362008
Direct Results Count Pct Average Min Max Total Damage
hit 33.1 75.79% 23823.22 14805 39394 788934
crit 10.6 24.21% 54161.13 33636 89504 573074

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:-1.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Arms_T11_372
colossus_smash rage 14.7% 738.5 18
execute rage 11.5% 1446.1 26
heroic_strike rage 10.6% 1385.6 12
mortal_strike rage 35.2% 1486.4 18
overpower rage 7.7% 7037.7 5
rend rage 5.8% 2817.1 9
slam rage 13.5% 2194.2 14
Resource Gains Type Count rage Average Overflow
anger_management rage 1809.6 147.3 0.1 2.3%
avoided_attacks rage 5.7 90.2 15.8 0.0%
battle_shout rage 5.5 109.6 20.0 0.0%
berserker_rage rage 15.2 75.9 5.0 0.0%
blood_frenzy rage 12.5 236.6 19.0 5.2%
melee_main_hand rage 128.7 3877.7 30.1 2.4%
sudden_death rage 10.1 80.4 8.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 3.0 0.0 183.7sec 362.7sec 99% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 12.7 0.0 32.9sec 32.9sec 5% 6%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 15.2 0.0 30.8sec 30.8sec 33% 33%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance 2.0 0.0 365.4sec 365.4sec 1% 100%

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.3sec 123.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
colossus_smash 29.4 6.3 15.5sec 12.7sec 47% 41%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_calm 3.5 0.0 128.2sec 128.2sec 8% 7%

Database details

  • id:
  • cooldown name:buff_deadly_calm
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
executioner_talent 2.5 17.2 35.5sec 4.5sec 19% 39%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.7sec 339.7sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.3sec 107.3sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 3.4 0.0 103.3sec 103.3sec 2% 9%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
inner_rage 4.5 0.0 96.5sec 96.5sec 15% 15%

Database details

  • id:1134
  • cooldown name:buff_inner_rage
  • tooltip:Heroic Strike and Cleave cooldown reduced.
  • max_stacks:1
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
lambs_to_the_slaughter 1.1 84.0 248.1sec 5.3sec 100% 99%

Database details

  • id:
  • cooldown name:buff_lambs_to_the_slaughter
  • tooltip:(null)
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 14.2 25.0 31.9sec 11.3sec 65% 66%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overpower 14.8 0.6 29.3sec 28.1sec 5% 18%

Database details

  • id:
  • cooldown name:buff_overpower
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:1.00
  • default_chance:100.00%
recklessness 2.0 0.0 363.9sec 363.9sec 5% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
taste_for_blood 70.1 2.8 6.4sec 6.2sec 29% 90%

Database details

  • id:
  • cooldown name:buff_taste_for_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:9.00
  • cooldown:5.00
  • default_chance:100.00%
tier11_4pc_melee 2.0 75.1 370.6sec 5.8sec 96% 94%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
wrecking_crew 13.5 13.2 34.0sec 16.8sec 55% 54%

Database details

  • id:
  • cooldown name:buff_wrecking_crew
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 2.3%

Procs

Count Interval
munched_deep_wounds 29.5 15.5sec
rolled_deep_wounds 31.3 15.0sec
strikes_of_opportunity 127.5 3.5sec
sudden_death 36.2 12.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.30%
σ of the average dps 8.0754
2 * σ / μ 0.0586%
95% Confidence Intervall ( μ ± 2σ ) ( 27525.32 - 27557.62 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27517.24 - 27565.69 )
Sample Data
σ 807.5368
Minimum 24628.73
Maximum 31917.42
Spread ( max - min ) 7288.68
Range ( max - min ) / 2 3644.34
Range% 13.23
10th Percentile 26524.21
90th Percentile 28597.66
( 90th Percentile - 10th Percentile ) 2073.46
Approx. Iterations needed for
1% dps error 34
0.1% dps error 3438
0.1 scale factor error with delta=300 5796
0.05 scale factor error with delta=300 23186
0.01 scale factor error with delta=300 579658
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
6 stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
7 recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
8 berserker_rage,if=!buff.deadly_calm.up&rage<70
9 deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
A sweeping_strikes,if=target.adds>0
B bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
C cleave,if=target.adds>0
D inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
E heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
F overpower,if=buff.taste_for_blood.remains<=1.5
G mortal_strike,if=target.health_pct>20|rage>=30
H execute,if=buff.battle_trance.up
I rend,if=!ticking
J colossus_smash,if=buff.colossus_smash.remains<0.5
K execute,if=(buff.deadly_calm.up|buff.recklessness.up)
L mortal_strike
M overpower
N execute
O slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
P battle_shout,if=rage<20

Sample Sequence

013458P7GJ69EIGEMJEGMODEFGEJMIGEMOEGOM8GEOIGJEMDGEMJEGMFEJGEIMGOMG8OMGOIJGMOPGMOGOIGMJMG8OGEJMIGMOGEOMGOIGJMGM8JGMO9EIGEMJEGOEMDGDEJOGIMJGO8MGJMGOIPGJMGEMJGOIGJM8GMOGEMOIGEMOGJMGOIGMO8GMOGEMJIEPGEJMGMOEGOEIGJM8GEMOJ9EGMOEIGEJMDEFGDEJMEGOIGMJ8FGEMOEGMOIGMPDEFGJMGOJGIMG8MJFDEGMOGOIMGOMGOJMGIJM8GOMGEOJIMGOPGJMGEMOIG8JMG9EOMEGOEIGDEMOGMJGMOIFG8EMOGOJGMOIGMPFGMOGEMOIGJ8MGOM57K6KGKIGJKGMJNFGMING8MNNNGMNNGIJMGMNNLMNNIG8MNNGJMNGMINGMNNGMNNNGI8JLMNJGEMNNGIJMGENM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6261 4977 4548
Agility 729 145 20
Stamina 7658 6035 5862
Intellect 55 53 20
Spirit 82 82 20
Health 150167 127515 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.59% 9.59% 982
Spell Crit 20.36% 15.36% 2575
Spell Haste 11.23% 5.93% 760
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14215 10354 190
Melee Hit 8.18% 8.18% 982
Melee Crit 23.36% 15.96% 2575
Melee Haste 5.93% 5.93% 760
Expertise 12.69 12.69 381
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.02% 15.02% 1259

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 2
Taste for Blood 3
Sweeping Strikes 1
Impale 2
Improved Hamstring 0
Improved Slam 2
Deadly Calm 1
Blood Frenzy 2
Lambs to the Slaughter 3
Juggernaut 1
Sudden Death 2
Wrecking Crew 2
Throwdown 1
Bladestorm 1
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 0
Rude Interruption 0
Piercing Howl 0
Flurry 0
Death Wish 0
Enrage 0
Die by the Sword 0
Raging Blow 0
Rampage 0
Heroic Fury 0
Furious Attacks 0
Meat Cleaver 0
Intensify Rage 0
Bloodsurge 0
Skirmisher 0
Titan's Grip 0
Single-Minded Fury 0
Protection Rank
Incite 1
Toughness 0
Blood and Thunder 2
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Arms_T11_372
origin="http://chardev.org/?profile=36399"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
glyphs=thunder_clap/cleaving/sweeping_strikes/battle/berserker_rage/intimidating_shout/slam/overpower/mortal_strike
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
actions+=/recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/berserker_rage,if=!buff.deadly_calm.up&rage<70
actions+=/deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
actions+=/sweeping_strikes,if=target.adds>0
actions+=/bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
actions+=/cleave,if=target.adds>0
actions+=/inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
actions+=/heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
actions+=/overpower,if=buff.taste_for_blood.remains<=1.5
actions+=/mortal_strike,if=target.health_pct>20|rage>=30
actions+=/execute,if=buff.battle_trance.up
actions+=/rend,if=!ticking
actions+=/colossus_smash,if=buff.colossus_smash.remains<0.5
actions+=/execute,if=(buff.deadly_calm.up|buff.recklessness.up)
actions+=/mortal_strike
actions+=/overpower
actions+=/execute
actions+=/slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
actions+=/battle_shout,if=rage<20
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4548
# gear_agility=20
# gear_stamina=5862
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=381
# gear_hit_rating=982
# gear_crit_rating=2575
# gear_haste_rating=760
# gear_mastery_rating=1259
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_1h_T11_372 : 27975dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27975.3 17.84 / 0.06% 2213.8 12.6 12.7 rage 8.52% 46.0
Origin http://chardev.org/?profile=36557
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • battle
  • berserker_rage
  • bloody_healing
  • slam
  • raging_blow
  • bloodthirst

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:24714|23438|20949|17117|7266|3790|2357&chds=0,49427&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++24714++execute,C79C6E,0,0,15|t++23438++slam,C79C6E,1,0,15|t++20949++bloodthirst,C79C6E,2,0,15|t++17117++raging_blow,C79C6E,3,0,15|t++7266++colossus_smash,C79C6E,4,0,15|t++3790++melee_main_hand,C79C6E,5,0,15|t++2357++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:34,14,10,8,7,6,6,6,4,4,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|heroic_strike|melee_off_hand|slam_mh|deep_wounds|raging_blow_mh|execute|slam_oh|raging_blow_oh|colossus_smash&chtt=Warrior_Fury_1h_T11_372+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:cpoYZfYdmjosquzwz1y0212uomljjnw134667766532yrleeeafggjlkmomprruwrojceebhkkoporsrtusuurohbcbZdghklmoqqstuvvtpjedccehikmmoppqrsttrniecccehjlnopqrsrnnonkgcaaabeghjklnopqrssqnjebccdgjlnooqqrstttrokfdccdgiklnopqrstttsokgdccdfijlnopqrstttspkgeccdfikmnoprrstttrokgeccdfhjlnopqrstttsplheddefhjlmnomklmnnmkhecbabdegijklmnopppnmjgedddfgijlmnnopqqqpoligeeefgijkmmnopqqqpomjhgffghiklmnnopppppomkhgfffghjkllmnoopppomkjhggghijklmnnooopoonljihhhhijihghikllmnnmmlkkjkk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Warrior_Fury_1h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:84552331210223100zyywuutttsrrqpppoomklihhhggfefeddcbbaaaZaaZZaZaaZaaZaaZaaZaaZaaZaaZaZZaZZaZZaZaaaabbbcccccdddeeeefffffffeeeeeddddccccccccccddeffgghhiijjkkllllllkkjjihhggffeeddccbbbaaaZZZZZZZZZZZZZaaaaaaabbbccccddddeeeeeeeffeeeeeeeeeeeefffffgggffffffffeedddcccbbbbbbcccdddeeeeffffggggggggfffffffffffffffffffgggggggggggggggggggffffffeeeeeeeeddddddcccccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbccccddddeefffgghhhhiiiiiiiiihhhhhhhhhhhhhhhiiijjjkkkkklllllmmmmmnnnno&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27975|max=52576&chxp=1,1,53,100&chtt=Warrior_Fury_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,6,10,11,16,21,37,64,71,98,133,173,224,261,333,365,436,504,546,568,566,612,627,561,585,515,480,422,358,321,264,174,161,141,88,69,57,42,21,19,13,12,5,2,2,0,0,2,1&chds=0,627&chbh=5&chxt=x&chxl=0:|min=24869|avg=27975|max=31663&chxp=0,1,46,100&chtt=Warrior_Fury_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T11_372 27975
battle_shout 0 0.0% 12.3 36.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.25 12.25 0.00 0.00 1.5151 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.3 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 6.9 55.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 9477 33.9% 134.8 3.35sec 31788 20949 23356 48723 106987 33.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.84 134.84 0.00 0.00 1.5174 0.0000 4286245
Direct Results Count Pct Average Min Max Total Damage
hit 90.0 66.76% 23355.58 14404 51936 2102299
crit 44.8 33.24% 48722.80 29672 106987 2183946

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 532 1.9% 21.9 21.09sec 10990 7266 8745 18257 28058 23.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.89 21.89 0.00 0.00 1.5125 0.0000 240541
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 76.40% 8745.48 6477 13621 146237
crit 5.2 23.60% 18257.43 13343 28058 94303

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 1638 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 434 1709 0 0.0% 0.0% 95.9%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 209.89 433.64 433.64 0.0000 1.0000 740980
Direct Results Count Pct Average Min Max Total Damage
hit 209.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 433.6 100.00% 1708.75 302 7472 740980

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:976.80
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1618 5.8% 19.6 4.57sec 37338 24714 30329 62008 133098 22.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.60 19.60 0.00 0.00 1.5108 0.0000 731763
Direct Results Count Pct Average Min Max Total Damage
hit 15.3 77.88% 30329.26 2166 64611 462903
crit 4.3 22.12% 62007.73 5976 133098 268859

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2869 10.3% 55.5 8.01sec 23374 0 15935 32813 69783 44.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.52 55.52 0.00 0.00 0.0000 0.0000 1297650
Direct Results Count Pct Average Min Max Total Damage
hit 31.1 55.93% 15935.48 9399 33875 494802
crit 24.5 44.07% 32813.12 19362 69783 802849

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3785 13.5% 262.0 1.73sec 6535 3790 6751 13902 27413 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.00 262.00 0.00 0.00 1.7243 0.0000 1712084
Direct Results Count Pct Average Min Max Total Damage
hit 96.4 36.81% 6751.46 4409 13307 651094
crit 53.4 20.38% 13902.13 9082 27413 742290
glance 62.9 24.02% 5063.09 3307 9981 318700
miss 49.2 18.79% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2354 8.4% 261.4 1.73sec 4073 2357 4207 8667 17133 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.36 261.36 0.00 0.00 1.7285 0.0000 1064606
Direct Results Count Pct Average Min Max Total Damage
hit 96.0 36.73% 4207.35 2756 8317 403902
crit 53.4 20.42% 8666.98 5677 17133 462654
glance 62.8 24.01% 3155.74 2067 6238 198051
miss 49.2 18.83% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 2640 9.4% 46.0 9.50sec 25953 17117 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.02 46.02 0.00 0.00 1.5163 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 1622 5.8% 46.0 9.50sec 15947 0 12111 25412 50363 28.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.02 46.02 0.00 0.00 0.0000 0.0000 733824
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 71.16% 12110.78 8185 24448 396535
crit 13.3 28.84% 25412.21 16861 50363 337289

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 1018 3.6% 46.0 9.50sec 10006 0 7602 15967 31477 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.02 46.02 0.00 0.00 0.0000 0.0000 460421
Direct Results Count Pct Average Min Max Total Damage
hit 32.8 71.26% 7602.15 5116 15280 249289
crit 13.2 28.74% 15966.93 10538 31477 211132

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 3062 10.9% 39.1 11.31sec 35415 23438 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.11 39.11 0.00 0.00 1.5110 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 39.1 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1842 6.6% 39.1 11.31sec 21306 0 16329 33904 66299 28.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.11 39.11 0.00 0.00 0.0000 0.0000 833261
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.68% 16328.87 11199 32184 457765
crit 11.1 28.32% 33903.57 23070 66299 375496

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74
slam_oh 1220 4.4% 39.1 11.31sec 14110 0 10811 22413 43104 28.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.11 39.11 0.00 0.00 0.0000 0.0000 551819
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.57% 10810.60 7430 20924 302578
crit 11.1 28.43% 22412.73 15305 43104 249241

Action details: slam_oh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_1h_T11_372
bloodthirst rage 47.2% 1589.4 20
colossus_smash rage 7.5% 558.9 20
death_wish rage 0.5% 0.0 7
execute rage 9.8% 1300.6 29
heroic_strike rage 19.6% 1161.2 20
raging_blow rage 15.4% 1353.3 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.3 367.6 30.0 0.0%
berserker_rage rage 6.9 58.5 8.5 0.3%
melee_main_hand rage 212.8 3558.2 16.7 1.1%
melee_off_hand rage 212.1 1780.1 8.4 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 20.1 0.0 21.4sec 21.4sec 8% 8%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 6.9 0.0 55.3sec 55.3sec 15% 15%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.1sec 123.1sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 39.3 1.1 11.3sec 11.0sec 16% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 14.6 41.9 29.2sec 7.4sec 58% 56%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 18.5 45.8sec 4.6sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 77.8 152.2 5.8sec 2.0sec 70% 69%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.1sec 339.1sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 104.9sec 104.9sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.1 0.0 41.0sec 41.0sec 10% 16%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 13.6 13.1 33.1sec 16.4sec 51% 51%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.5 46.1sec 32.6sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.7 44.3 365.0sec 9.5sec 96% 95%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.8%

Procs

Count Interval
munched_deep_wounds 47.7 9.7sec
rolled_deep_wounds 35.2 13.1sec

Statistics & Data Analysis

DPS
Population
Convergence 71.22%
σ of the average dps 8.9197
2 * σ / μ 0.0638%
95% Confidence Intervall ( μ ± 2σ ) ( 27957.45 - 27993.12 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27948.53 - 28002.04 )
Sample Data
σ 891.9746
Minimum 24869.48
Maximum 31663.37
Spread ( max - min ) 6793.89
Range ( max - min ) / 2 3396.94
Range% 12.14
10th Percentile 26846.73
90th Percentile 29111.63
( 90th Percentile - 10th Percentile ) 2264.91
Approx. Iterations needed for
1% dps error 40
0.1% dps error 4066
0.1 scale factor error with delta=300 7072
0.05 scale factor error with delta=300 28288
0.01 scale factor error with delta=300 707216
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F slam,if=buff.bloodsurge.react
G execute,if=rage>=50
H berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
I raging_blow
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEIEAEAIEFEAIEFECAEIAEJAEHIAEFAEFAEICAEAEIEAEFEAJEICAEHAEFEFEFEIEECAEIAEJAEIEEAIEECAEHIEEIEEIEJECAEFEHIEAEIEF7EIECEFIEJEAIEEFECAEIEFEHIEAEIEJCAEFEIEEAIEEIAECEFEAFEIEJAEIAEECEIE6EIEFEHIAEFAECEFAIJAEFEAFEEAFEACEAIEFEIEFE7IEAFECEFEFEIEJAEIAEAECAEFAEIEEFEIEAECAEFEAFEFIEAJEIEAFCAEIAEEHIEAEIEECEAFEIJEAEIEEHICAEFAEIEFEIEJAEFCAEFAEFEIE7BDDDDEACEFBEIEGJEFEBFCAEGAEGEGEAIE6AGEAGECEFABEGEAGEAFEGEFCAEBEFEGEFHIEBEGCEAJEABEAFEGE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6222 4940 4513
Agility 729 145 20
Stamina 7572 5953 5780
Intellect 55 53 20
Spirit 82 82 20
Health 148963 126367 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 6.10% 6.10% 625
Spell Crit 20.20% 15.20% 2545
Spell Haste 13.93% 8.50% 1089
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14130 10280 190
Melee Hit 8.20% 8.20% 625
Melee Crit 23.19% 15.79% 2545
Melee Haste 8.50% 8.50% 1089
Expertise 26.64 26.64 800
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.51% 12.51% 809

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 0
Single-Minded Fury 1
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_1h_T11_372
origin="http://chardev.org/?profile=36557"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
glyphs=death_wish/cleaving/heroic_throw/battle/berserker_rage/bloody_healing/slam/raging_blow/bloodthirst
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands=plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4513
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=800
# gear_hit_rating=625
# gear_crit_rating=2545
# gear_haste_rating=1089
# gear_mastery_rating=809
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_2h_T11_372 : 27829dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27828.9 18.63 / 0.07% 2190.4 12.7 12.8 rage 8.49% 46.3
Origin http://chardev.org/?profile=36611
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • bloody_healing
  • battle
  • berserker_rage
  • bloodthirst
  • raging_blow
  • slam

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27017|21531|18554|17727|9823|3664|2275&chds=0,54034&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++27017++raging_blow,C79C6E,0,0,15|t++21531++execute,C79C6E,1,0,15|t++18554++bloodthirst,C79C6E,2,0,15|t++17727++slam,C79C6E,3,0,15|t++9823++colossus_smash,C79C6E,4,0,15|t++3664++melee_main_hand,C79C6E,5,0,15|t++2275++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:30,13,12,9,8,7,7,7,4,3&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|raging_blow_mh|heroic_strike|melee_off_hand|deep_wounds|raging_blow_oh|slam_mh|execute|colossus_smash&chtt=Warrior_Fury_2h_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:foqbdaXbnimjkpxuvsrx10ytmkcffow0vy0675zz134xskccZbhhiiikmommporsnlgYZZagjjlllpqpqpprrplfZZYZdgghhjmnoppqrsqmgbaZbehijjkmoooopqqokfbZZbdhijjlmoppnjklkhdZXXYbdffghjllmmmnonjfbYYadgijklnoooopqqplhdbabegijjkmnooppppnkgcaabdfhijlmooppqqqolhdbabdfhijkmnooppppolhdbabdfhijkmnooppqpolhebbbdfhijklmjhhijjigdaYYZacdefghijkkkllkifdbbbdeghhiklmmnooonligeddefghjklmmnoooonljhfeefghijklmnoooponmkifeeefghijklmnnooonmkihfffghijjklmnooooonmkjhgghhijjhghijklllmlkjihhhi&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=72&chtt=Warrior_Fury_2h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:8453112010z1110yzxxxvssrrrqopononmmlijhgggffeeedccbbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaabbbbbccccddddddddddddcccccbbbbbbbbccddeeffgghhiijjkkkkkkkkkjiihhgffeeddccbbbaaZZYYZZZZYYYYZYYZZZZZZZaaaaabbbbbcccccccdddddcccdddddeeeeffffffffffeeeeddcccbbbaaaaaabbbbccccddddeeeeffffffffffffffffffffffffffffffeeeeeeeeeeeeeddddddddddcccccccccbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbcccdddeeeeffffffffffffffeeeeeeeeeeefffgghhhiiijjkkkklllmmmmnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27829|max=54299&chxp=1,1,51,100&chtt=Warrior_Fury_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,4,3,11,9,9,17,27,42,65,80,104,109,173,218,278,322,382,426,465,512,616,617,653,592,593,565,549,475,404,342,325,232,215,163,94,88,77,50,36,20,10,11,7,6,1,0,0,1&chds=0,653&chbh=5&chxt=x&chxl=0:|min=24279|avg=27829|max=31450&chxp=0,1,50,100&chtt=Warrior_Fury_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T11_372 27829
battle_shout 0 0.0% 12.1 37.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.05 12.05 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 9.5 44.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.54 9.54 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.5 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 8229 29.6% 132.2 3.41sec 28148 18554 20533 42841 94424 34.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.21 132.21 0.00 0.00 1.5171 0.0000 3721472
Direct Results Count Pct Average Min Max Total Damage
hit 87.1 65.86% 20532.82 12557 45837 1787920
crit 45.1 34.14% 42840.54 26126 94424 1933552

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 719 2.6% 21.9 21.10sec 14865 9823 11725 24491 36866 24.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.87 21.87 0.00 0.00 1.5133 0.0000 325172
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 75.40% 11725.00 8740 17896 193386
crit 5.4 24.60% 24490.86 18203 36866 131785

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 2047 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 423 2189 0 0.0% 0.0% 93.5%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 183.36 422.94 422.94 0.0000 1.0000 925861
Direct Results Count Pct Average Min Max Total Damage
hit 183.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 422.9 100.00% 2189.12 422 10885 925861

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:936.80
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1185 4.3% 16.5 5.46sec 32510 21531 26229 53504 115844 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.48 16.48 0.00 0.00 1.5099 0.0000 535771
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 76.97% 26229.13 467 65311 332730
crit 3.8 23.03% 53503.71 3826 115844 203041

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2489 8.9% 54.7 8.13sec 20591 0 13897 28708 61587 45.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.67 54.67 0.00 0.00 0.0000 0.0000 1125734
Direct Results Count Pct Average Min Max Total Damage
hit 30.0 54.81% 13897.17 8194 29897 416417
crit 24.7 45.19% 28707.83 16879 61587 709316

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3657 13.1% 176.8 2.57sec 9355 3664 9425 19419 37734 21.3% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.80 176.80 0.00 0.00 2.5532 0.0000 1654007
Direct Results Count Pct Average Min Max Total Damage
hit 66.2 37.47% 9424.64 6171 18317 624332
crit 37.6 21.27% 19418.92 12712 37734 730120
glance 42.4 23.97% 7067.82 4628 13738 299555
miss 30.6 17.29% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2271 8.2% 176.1 2.57sec 5831 2275 5874 12111 23583 21.2% 17.3% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.14 176.14 0.00 0.00 2.5628 0.0000 1027004
Direct Results Count Pct Average Min Max Total Damage
hit 66.1 37.51% 5874.49 3857 11448 388094
crit 37.4 21.24% 12110.83 7945 23583 453186
glance 42.2 23.95% 4403.32 2910 8586 185724
miss 30.5 17.30% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 5297 19.0% 58.5 7.71sec 40986 27017 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.45 58.45 0.00 0.00 1.5170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 58.5 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 3252 11.7% 58.5 7.71sec 25161 0 18981 39839 75404 29.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.45 58.45 0.00 0.00 0.0000 0.0000 1470700
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.37% 18980.93 12579 36604 780765
crit 17.3 29.63% 39839.16 25913 75404 689935

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 2045 7.3% 58.5 7.71sec 15825 0 11925 25055 47127 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.45 58.45 0.00 0.00 0.0000 0.0000 925016
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.30% 11925.43 7862 22877 490029
crit 17.4 29.70% 25055.24 16196 47127 434986

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 1935 7.0% 32.7 13.46sec 26772 17727 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.69 32.69 0.00 0.00 1.5103 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1935 7.0% 32.7 13.46sec 26772 0 20484 42260 85658 28.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.69 32.69 0.00 0.00 0.0000 0.0000 875302
Direct Results Count Pct Average Min Max Total Damage
hit 23.3 71.12% 20484.23 14684 41582 476324
crit 9.4 28.88% 42259.69 30249 85658 398978

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_2h_T11_372
bloodthirst rage 46.0% 1407.4 20
colossus_smash rage 7.5% 756.7 20
death_wish rage 0.5% 0.0 7
execute rage 8.1% 1157.0 28
heroic_strike rage 18.5% 1060.9 19
raging_blow rage 19.5% 2135.4 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.1 361.6 30.0 0.0%
berserker_rage rage 9.5 90.9 9.5 0.9%
melee_main_hand rage 146.2 3554.6 24.3 1.6%
melee_off_hand rage 145.7 1789.4 12.3 0.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 19.9 0.0 21.6sec 21.6sec 8% 9%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 9.5 0.0 44.7sec 44.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.2sec 123.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 33.5 6.2 13.2sec 11.2sec 27% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 15.1 30.4 28.1sec 9.1sec 52% 51%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 15.4 46.2sec 5.5sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 49.3 145.1 9.2sec 2.3sec 78% 76%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.3sec 339.3sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 105.8sec 105.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.3 0.0 40.8sec 40.8sec 10% 17%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 14.4 20.6 31.4sec 12.6sec 61% 62%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.5 46.2sec 32.7sec 29% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 57.4 389.4sec 7.7sec 99% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.9%

Procs

Count Interval
munched_deep_wounds 34.4 13.4sec
rolled_deep_wounds 31.2 14.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.89%
σ of the average dps 9.3155
2 * σ / μ 0.0669%
95% Confidence Intervall ( μ ± 2σ ) ( 27810.23 - 27847.49 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27800.91 - 27856.81 )
Sample Data
σ 931.5494
Minimum 24278.69
Maximum 31450.23
Spread ( max - min ) 7171.54
Range ( max - min ) / 2 3585.77
Range% 12.89
10th Percentile 26642.49
90th Percentile 29016.61
( 90th Percentile - 10th Percentile ) 2374.12
Approx. Iterations needed for
1% dps error 44
0.1% dps error 4482
0.1 scale factor error with delta=300 7713
0.05 scale factor error with delta=300 30854
0.01 scale factor error with delta=300 771363
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
G raging_blow
H slam,if=buff.bloodsurge.react
I execute,if=rage>=50
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEGAEHEGEAHEGEAECAEGAEHAEFGEHEAGEJAECAEEEAGEHEGEHEACEAGEHEFGEHEAGEAHECAEJAEGAEAEGEAEGECFEGEAEAGEAHEGHAECAEGAEHEGEHJE7GEACEAGEEGEAHEGEHEACEAGEAJEAFGEAHEAGEAHECAEGAEEGEEGEHJACEAGEAHEGEEGEHCEAFGEH6EGEHEAJEHEACEGEHEGEHEGECAEGJEAGEEG7EECAEGHEEGEJAEGEHCAEGAEEFGAEHEGEHECEGAJEAHEGEAHEGEHCAEGEHEFGEHEGEJECAEHEEEFAGEHEGECAHEAGEAHEGEJEGECAEGEEGEH7BDDDDCJAEGBEHIEGEHBCAEFGAEBEGEHBEH6EGBCAEGEABEFAGEHBEGEICEGEBEHEFGBEIEAGCEBEJEGBEHE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6519 5223 4782
Agility 729 145 20
Stamina 8265 6613 6440
Intellect 55 53 20
Spirit 82 82 20
Health 158665 135607 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 7.87% 7.87% 806
Spell Crit 21.01% 16.01% 2691
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14783 10845 190
Melee Hit 9.71% 9.71% 806
Melee Crit 24.00% 16.61% 2691
Melee Haste 5.13% 5.13% 657
Expertise 26.01 26.01 781
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.51% 16.51% 1526

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 1
Single-Minded Fury 0
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_2h_T11_372
origin="http://chardev.org/?profile=36611"
level=85
race=worgen
role=attack
use_pre_potion=1
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
glyphs=death_wish/cleaving/heroic_throw/bloody_healing/battle/berserker_rage/bloodthirst/raging_blow/slam
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4782
# gear_agility=20
# gear_stamina=6440
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=806
# gear_crit_rating=2691
# gear_haste_rating=657
# gear_mastery_rating=1526
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket1=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Auras/Buffs

Constant Buff
abominations_might
arcane_tactics
battle_shout
communion
demonic_Pact
devotion_aura
elemental_oath
fel_intelligence
ferocious_inspiration
flametongue_totem
honor_among_thieves
horn_of_winter
hunting_party
improved_icy_talons
leader_of_the_pack
mana_spring_totem
mind_quickening
moonkin
qiraji_fortitude
rampage
roar_of_courage
strength_of_earth
trueshot
unleashed_rage
windfury_totem
wrath_of_air

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
0.0 0.00 / 0.00% 0.0 853530.3 0.0 health 100.02% 0.0

Charts

http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777776666555544443333322222211111110000000zzzzzzzyyyyyyyyxxxxxxxwwwwwwwwvvvvvvvvuuuuuuuuuttttttttsssssssssrrrrrrrrqqqqqqqqpppppppoooooooonnnnnnnnmmmmmmmlllllllllkkkkkkkkjjjjjjjjjiiiiiiiihhhhhhhhggggggggffffffffeeeeeeeeddddddddccccccccbbbbbbbbaaaaaaaZZZZZZZZYYYYYYYYXXXXXXXXWWWWWWWWVVVVVVVVUUUUUUUUUTTTTTTTTSSSSSSSSSRRRRRRRQQQQQQQQPPPPPPPPOOOOOOOONNNNNNNNMMMMMMMMMMMMMLLLLLLLLLLLLLLKKKKKKKKKKKKKKJJJJJJJJJJJJJJIIIIIIIIIIIIIIIHHHHHHHHHHHHHHHGGGGGGGGGGG&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=385384627&chtt=Fluffy_Pillow+Health+Timeline&chts=dddddd,18&chco=336600 http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=0|max=0&chxp=1,1,-nan,100&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18

Abilities

Resources

Resource Usage Type Res% DPR RPE
Fluffy_Pillow
Resource Gains Type Count health Average Overflow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs
bleeding

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_bleed

Database details

  • id:
  • cooldown name:buff_blood_frenzy_bleed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_physical

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
brittle_bones

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
corrosive_spit

Database details

  • id:95466
  • cooldown name:buff_corrosive_spit
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
critical_mass

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:Spells have a $s1% additional chance to critically hit.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
curse_of_elements

Database details

  • id:
  • cooldown name:buff_curse_of_elements
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_roar

Database details

  • id:99
  • cooldown name:buff_demoralizing_roar
  • tooltip:Reduces physical damage caused by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_screech

Database details

  • id:24423
  • cooldown name:buff_demoralizing_screech
  • tooltip:Physical damage reduced by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
demoralizing_shout

Database details

  • id:
  • cooldown name:buff_demoralizing_shout
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
earth_and_moon

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
ebon_plague

Database details

  • id:
  • cooldown name:buff_ebon_plague
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
expose_armor

Database details

  • id:
  • cooldown name:buff_expose_armor
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
faerie_fire

Database details

  • id:91565
  • cooldown name:buff_faerie_fire
  • tooltip:Armor reduced by $s1%. Cannot stealth or turn invisible.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
hemorrhage

Database details

  • id:
  • cooldown name:buff_hemorrhage
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
hunters_mark

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
infected_wounds

Database details

  • id:
  • cooldown name:buff_infected_wounds
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_just

Database details

  • id:
  • cooldown name:buff_judgements_of_the_just
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_breath

Database details

  • id:24844
  • cooldown name:buff_lightning_breath
  • tooltip:Increases magic damage taken by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
mangle

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
master_poisoner

Database details

  • id:
  • cooldown name:buff_master_poisoner
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
poisoned

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ravage

Database details

  • id:50518
  • cooldown name:buff_ravage
  • tooltip:Increases physical damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
savage_combat

Database details

  • id:
  • cooldown name:buff_savage_combat
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
scarlet_fever

Database details

  • id:
  • cooldown name:buff_scarlet_fever
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_and_flame

Database details

  • id:17800
  • cooldown name:buff_shadow_and_flame
  • tooltip:Chance to be critically hit with spells increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sunder_armor

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
tailspin

Database details

  • id:90315
  • cooldown name:buff_tailspin
  • tooltip:Melee and ranged attack speed reduced by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tear_armor

Database details

  • id:95467
  • cooldown name:buff_tear_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
tendon_rip

Database details

  • id:50271
  • cooldown name:buff_tendon_rip
  • tooltip:All bleed effects cause $s1% additional damage.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
thunder_clap

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vindication

Database details

  • id:
  • cooldown name:buff_vindication
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 0.00%
σ of the average dps 0.0000
2 * σ / μ 0.0000%
95% Confidence Intervall ( μ ± 2σ ) ( 0.00 - 0.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 0.00% - 0.00% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 0.00 - 0.00 )
Sample Data
σ 0.0000
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range ( max - min ) / 2 0.00
Range% 0.00
10th Percentile 0.00
90th Percentile 0.00
( 90th Percentile - 10th Percentile ) 0.00
Approx. Iterations needed for
1% dps error 0
0.1% dps error 0
0.1 scale factor error with delta=300 0
0.05 scale factor error with delta=300 0
0.01 scale factor error with delta=300 0
DPS Timeline Chart

Action Priority List

# action,conditions
0 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 461232478 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 8.00% 8.00% 0

Gear

Encoded
head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty

Talents

Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Improved Cower 0
Bloodthirsty 0
Spiked Collar 0
Boar's Speed 0
Culling the Herd 0
Lionhearted 0
Swoop 0
Charge 0
Heart of the Phoenix 0
Spider's Bite 0
Great Resistance 0
Rabid 0
Lick Your Wounds 0
Call of the Wild 0
Shark Attack 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Charge 0
Great Stamina 0
Natural Armor 0
Spiked Collar 0
Boar's Speed 0
Blood of the Rhino 0
Pet Barding 0
Culling the Herd 0
Guard Dog 0
Lionhearted 0
Thunderstomp 0
Grace of the Mantis 0
Great Resistance 0
Last Stand 0
Taunt 0
Roar of Sacrifice 0
Intervene 0
Silverback 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Boar's Speed 0
Mobility 0
Mobility 0
Owl's Focus 0
Spiked Collar 0
Culling the Herd 0
Lionhearted 0
Carrion Feeder 0
Great Resistance 0
Cornered 0
Feeding Frenzy 0
Wolverine Bite 0
Roar of Recovery 0
Bullheaded 0
Grace of the Mantis 0
Wild Hunt 0
Roar of Sacrifice 0

Profile

#!./simc

enemy=Fluffy_Pillow
origin="unknown"
level=88
race=humanoid
role=tank
use_pre_potion=1
talents=http://www.wowhead.com/talent#enemy-000000000000000000000000000000000000000000000000000000000000000
actions=snapshot_stats
# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per second.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg

Convergence

Rate at which multipling iterations by convergence_scale reduces error

For default convergence_scale=2 it should itself approach 70.71% according to the central limit theorem

G%

Percentage of executes that resulted in glancing blows.

G%

Percentage of executes that resulted in blocking blows.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Max

Maximum crit damage over all iterations.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps_max - dps_min ) / ( 2 * dps_avg )

RPS In

Average resource points generated per second.

RPS Out

Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.